BLASTX nr result
ID: Ephedra28_contig00014262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00014262 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848309.1| hypothetical protein AMTR_s00013p00140650 [A... 50 5e-06 gb|ESW09893.1| hypothetical protein PHAVU_009G165200g [Phaseolus... 55 7e-06 >ref|XP_006848309.1| hypothetical protein AMTR_s00013p00140650 [Amborella trichopoda] gi|548851615|gb|ERN09890.1| hypothetical protein AMTR_s00013p00140650 [Amborella trichopoda] Length = 542 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = -3 Query: 485 ERKVFGGLLFACVGRGESFFGESNVDSSCFFEAFP 381 E +VFGGL+FAC RG FF E NVDSS F E FP Sbjct: 450 ETQVFGGLIFACTSRGLPFFREKNVDSSAFSEIFP 484 Score = 25.4 bits (54), Expect(2) = 5e-06 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 367 GEIGPPSVHPWEAENEDSKTS-LNFYSSMF 281 GEIGPP++ E + S L++YSS+F Sbjct: 495 GEIGPPALGEMERSQMNLTCSCLSYYSSVF 524 >gb|ESW09893.1| hypothetical protein PHAVU_009G165200g [Phaseolus vulgaris] Length = 535 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -3 Query: 476 VFGGLLFACVGRGESFFGESNVDSSCFFEAFP 381 VFGGL+FAC GRGESFFG NVDSS F E FP Sbjct: 451 VFGGLIFACYGRGESFFGRHNVDSSPFLENFP 482