BLASTX nr result
ID: Ephedra28_contig00013949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00013949 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK21516.1| unknown [Picea sitchensis] 61 1e-07 gb|ABR16882.1| unknown [Picea sitchensis] 57 3e-06 >gb|ABK21516.1| unknown [Picea sitchensis] Length = 177 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = +1 Query: 4 VHVSQMASCGATYGSSPSVRIEGFSCSSSEKQCIVSALA 120 V+VSQ +SCGA++G++ SVR+EGF CSSSEK CIVSALA Sbjct: 139 VNVSQKSSCGASFGANTSVRVEGFFCSSSEKHCIVSALA 177 >gb|ABR16882.1| unknown [Picea sitchensis] Length = 167 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 4 VHVSQMASCGATYGSSPSVRIEGFSCSSSEKQCIVSALA 120 V+VSQ +SCGA++G++ SVR+EGF SSSEK CIVSALA Sbjct: 129 VNVSQKSSCGASFGANTSVRVEGFFGSSSEKHCIVSALA 167