BLASTX nr result
ID: Ephedra28_contig00013185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00013185 (832 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840280.1| hypothetical protein AMTR_s00045p00052450 [A... 61 4e-07 gb|EMJ26557.1| hypothetical protein PRUPE_ppa000912mg [Prunus pe... 61 6e-07 gb|EOY06877.1| Calmodulin-binding transcription activator protei... 60 1e-06 gb|EOY06876.1| Calmodulin-binding transcription activator protei... 60 1e-06 gb|EOY06875.1| Calmodulin-binding transcription activator protei... 60 1e-06 gb|EOY06874.1| Calmodulin-binding transcription activator protei... 60 1e-06 ref|XP_002316071.2| hypothetical protein POPTR_0010s16290g [Popu... 57 8e-06 ref|XP_002519300.1| calmodulin-binding transcription activator (... 57 8e-06 >ref|XP_006840280.1| hypothetical protein AMTR_s00045p00052450 [Amborella trichopoda] gi|548841998|gb|ERN01955.1| hypothetical protein AMTR_s00045p00052450 [Amborella trichopoda] Length = 1091 Score = 61.2 bits (147), Expect = 4e-07 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYSD 24 ++ LSH M LD+ SM+PS+SQ+QLFS++DFSP+W+YSD Sbjct: 514 VSSLSHHMQLDIDSMSPSLSQEQLFSIIDFSPEWAYSD 551 >gb|EMJ26557.1| hypothetical protein PRUPE_ppa000912mg [Prunus persica] Length = 964 Score = 60.8 bits (146), Expect = 6e-07 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYSD 24 ++ LSH MHLD+ S+ PS+SQ+QLFS+ DFSPDW+YS+ Sbjct: 371 VSSLSHHMHLDIESLGPSLSQEQLFSIHDFSPDWAYSE 408 >gb|EOY06877.1| Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains, putative isoform 4 [Theobroma cacao] gi|508714981|gb|EOY06878.1| Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains, putative isoform 4 [Theobroma cacao] Length = 852 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LDV S+ PS+SQ+QLFS+VDFSPDW+YS Sbjct: 281 VSSLSHHMQLDVDSLGPSLSQEQLFSIVDFSPDWAYS 317 >gb|EOY06876.1| Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains, putative isoform 3 [Theobroma cacao] Length = 886 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LDV S+ PS+SQ+QLFS+VDFSPDW+YS Sbjct: 315 VSSLSHHMQLDVDSLGPSLSQEQLFSIVDFSPDWAYS 351 >gb|EOY06875.1| Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains, putative isoform 2 [Theobroma cacao] Length = 852 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LDV S+ PS+SQ+QLFS+VDFSPDW+YS Sbjct: 293 VSSLSHHMQLDVDSLGPSLSQEQLFSIVDFSPDWAYS 329 >gb|EOY06874.1| Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains, putative isoform 1 [Theobroma cacao] Length = 966 Score = 59.7 bits (143), Expect = 1e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LDV S+ PS+SQ+QLFS+VDFSPDW+YS Sbjct: 407 VSSLSHHMQLDVDSLGPSLSQEQLFSIVDFSPDWAYS 443 >ref|XP_002316071.2| hypothetical protein POPTR_0010s16290g [Populus trichocarpa] gi|550329933|gb|EEF02242.2| hypothetical protein POPTR_0010s16290g [Populus trichocarpa] Length = 964 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LD S+ PS+SQDQLFS+ DFSPDW+YS Sbjct: 379 VSSLSHHMQLDTDSLGPSLSQDQLFSIRDFSPDWAYS 415 >ref|XP_002519300.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541615|gb|EEF43164.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] Length = 999 Score = 57.0 bits (136), Expect = 8e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 137 ITRLSHQMHLDVVSMAPSISQDQLFSVVDFSPDWSYS 27 ++ LSH M LD+ S+ PS+SQ+QLFS+ DFSPDW+YS Sbjct: 413 VSSLSHHMQLDIESLGPSLSQEQLFSIHDFSPDWAYS 449