BLASTX nr result
ID: Ephedra28_contig00012866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00012866 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245861.1| PREDICTED: RNA-binding protein 5-like [Solan... 55 1e-05 >ref|XP_004245861.1| PREDICTED: RNA-binding protein 5-like [Solanum lycopersicum] Length = 1010 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 1 LGSQVQRRVDPRFEAQPGDSYKVTVQKKALARFHEMS 111 LGSQ ++VDP EAQ GDSYK +QKKA+ARF EMS Sbjct: 974 LGSQQSKKVDPNLEAQSGDSYKTLIQKKAIARFREMS 1010