BLASTX nr result
ID: Ephedra28_contig00011933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00011933 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842132.1| hypothetical protein AMTR_s00078p00115450 [A... 68 1e-09 >ref|XP_006842132.1| hypothetical protein AMTR_s00078p00115450 [Amborella trichopoda] gi|548844181|gb|ERN03807.1| hypothetical protein AMTR_s00078p00115450 [Amborella trichopoda] Length = 404 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/107 (35%), Positives = 54/107 (50%) Frame = +3 Query: 54 NTESPKTKGQCSKMKSAEIKNGETQYVQSYFVSCRQPVTXXXXXXXXXXXXXFQSNNPFV 233 N +PK K K K K G YF+S R+ VT F+S++P+ Sbjct: 229 NYYTPKKKYYTPKKKERMTKVGSDTSKNRYFLSNRRMVTQDERERAVKAANLFESSSPYF 288 Query: 234 LMVLRKSQVYQGFWLSFPKEFHTKWLPKDRTPFTLIAPSGMKTKAKY 374 +MV++ S VY+GF L+ P +F K LP ++ L+ PSG K K KY Sbjct: 289 IMVMKTSHVYKGFLLNIPLDFVKKHLPDEKPAMDLLDPSGKKWKVKY 335