BLASTX nr result
ID: Ephedra28_contig00011014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00011014 (528 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE76155.1| unknown [Picea sitchensis] 78 1e-12 gb|EXB38648.1| Two-component response regulator [Morus notabilis] 57 3e-06 gb|EOY29369.1| Type-b response regulator, putative [Theobroma ca... 56 4e-06 gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [... 56 4e-06 ref|XP_002980853.1| type B response regulator [Selaginella moell... 55 8e-06 ref|XP_002989348.1| hypothetical protein SELMODRAFT_447635 [Sela... 55 8e-06 >gb|ADE76155.1| unknown [Picea sitchensis] Length = 465 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 348 LQSVCRWVLVSAVMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 L VC W++VSAVMSTNGDT+VVMKGITHGACDY IKPIRIE Sbjct: 2 LHRVCPWIIVSAVMSTNGDTSVVMKGITHGACDYFIKPIRIE 43 >gb|EXB38648.1| Two-component response regulator [Morus notabilis] Length = 674 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 312 VMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 ++S NGDT +VMKGITHGACDYL+KPIRIE Sbjct: 95 MLSANGDTRLVMKGITHGACDYLLKPIRIE 124 >gb|EOY29369.1| Type-b response regulator, putative [Theobroma cacao] Length = 625 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 312 VMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 ++S NGDT +VMKGITHGACDYL+KP+RIE Sbjct: 95 MLSANGDTKLVMKGITHGACDYLLKPVRIE 124 >gb|EMJ28014.1| hypothetical protein PRUPE_ppa024819mg, partial [Prunus persica] Length = 659 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 312 VMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 ++S NGDT +VMKGITHGACDYL+KP+RIE Sbjct: 95 MLSANGDTKLVMKGITHGACDYLLKPVRIE 124 >ref|XP_002980853.1| type B response regulator [Selaginella moellendorffii] gi|300151392|gb|EFJ18038.1| type B response regulator [Selaginella moellendorffii] Length = 470 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -1 Query: 312 VMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 +MS NG+T+VVM+GITHGACDYL+KP+RIE Sbjct: 92 MMSGNGETSVVMEGITHGACDYLLKPVRIE 121 >ref|XP_002989348.1| hypothetical protein SELMODRAFT_447635 [Selaginella moellendorffii] gi|300142926|gb|EFJ09622.1| hypothetical protein SELMODRAFT_447635 [Selaginella moellendorffii] Length = 470 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = -1 Query: 312 VMSTNGDTTVVMKGITHGACDYLIKPIRIE 223 +MS NG+T+VVM+GITHGACDYL+KP+RIE Sbjct: 92 MMSGNGETSVVMEGITHGACDYLLKPVRIE 121