BLASTX nr result
ID: Ephedra28_contig00010952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00010952 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG43483.1| hypothetical protein 2_6489_02, partial [Pinus ta... 57 2e-06 gb|AFG43477.1| hypothetical protein 2_6489_02, partial [Pinus ta... 57 2e-06 gb|ABR17800.1| unknown [Picea sitchensis] 57 2e-06 gb|ABK26285.1| unknown [Picea sitchensis] 57 2e-06 >gb|AFG43483.1| hypothetical protein 2_6489_02, partial [Pinus taeda] Length = 130 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 YYVSWVVNESQVRLLSARYLADGKLHYVKSGTYYKTA 114 YYVSWVVNE+QVR+LS Y ADG+L ++ SGTY K+A Sbjct: 94 YYVSWVVNENQVRVLSVSYFADGRLQHLNSGTYEKSA 130 >gb|AFG43477.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125792|gb|AFG43478.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125794|gb|AFG43479.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125796|gb|AFG43480.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125798|gb|AFG43481.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125800|gb|AFG43482.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125804|gb|AFG43484.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125806|gb|AFG43485.1| hypothetical protein 2_6489_02, partial [Pinus taeda] gi|383125808|gb|AFG43486.1| hypothetical protein 2_6489_02, partial [Pinus taeda] Length = 130 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 YYVSWVVNESQVRLLSARYLADGKLHYVKSGTYYKTA 114 YYVSWVVNE+QVR+LS Y ADG+L ++ SGTY K+A Sbjct: 94 YYVSWVVNENQVRVLSVSYFADGRLQHLNSGTYEKSA 130 >gb|ABR17800.1| unknown [Picea sitchensis] Length = 376 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 YYVSWVVNESQVRLLSARYLADGKLHYVKSGTYYKTA 114 YYVSWVVNE+QVR+LS Y +DG+L +V SGTY K+A Sbjct: 340 YYVSWVVNENQVRVLSVSYFSDGRLQHVNSGTYEKSA 376 >gb|ABK26285.1| unknown [Picea sitchensis] Length = 376 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 4 YYVSWVVNESQVRLLSARYLADGKLHYVKSGTYYKTA 114 YYVSWVVNE+QVR+LS Y +DG+L +V SGTY K+A Sbjct: 340 YYVSWVVNENQVRVLSVSYFSDGRLQHVNSGTYEKSA 376