BLASTX nr result
ID: Ephedra28_contig00010921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00010921 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA85364.1| chitinase [Picea glauca] 60 2e-07 gb|AEF59002.1| class IV chitinase [Picea engelmannii x Picea gla... 60 2e-07 gb|ACY06323.1| class IV chitinase 4-4 [Pseudotsuga menziesii] 60 2e-07 gb|ACY06321.1| class IV chitinase 4-2 [Pseudotsuga menziesii] 60 2e-07 gb|ACY06320.1| class II chitinase 4-1 [Pseudotsuga menziesii] 60 2e-07 pdb|3HBD|A Chain A, Class Iv Chitinase Structure From Picea Abie... 60 2e-07 gb|ACP43362.1| class IV chitinase [Pseudotsuga menziesii] 60 2e-07 gb|ACM89955.1| class IV chitinase Chia4-Pa1 variant [Picea abies] 60 2e-07 gb|ACM89954.1| class IV chitinase Chia4-Pa2 variant [Picea abies] 60 2e-07 gb|ABR17664.1| unknown [Picea sitchensis] 60 2e-07 gb|ABK27070.1| unknown [Picea sitchensis] 60 2e-07 gb|ABK21634.1| unknown [Picea sitchensis] gi|116781053|gb|ABK219... 60 2e-07 gb|AAT09426.1| putative class IV chitanase [Picea abies] 60 2e-07 gb|AAQ17050.1| class IV chitinase Chia4-Pa1 [Picea abies] 60 2e-07 gb|AAQ17048.1| class IV chitinase Chia4-Pa1.3 [Picea abies] 60 2e-07 gb|AAQ17049.1| class IV chitinase Chia4-Pa1.1 [Picea abies] 60 2e-07 gb|AAQ17051.1| class IV chitinase Chia4-Pa2 [Picea abies] 60 2e-07 gb|ACY06325.1| class IV chitinase 4-6 [Pseudotsuga menziesii] 60 3e-07 gb|ACY06324.1| class IV chitinase 4-5 [Pseudotsuga menziesii] 60 3e-07 gb|AAL58877.1|AF457094_1 putative class IV chitinase, partial [P... 59 9e-07 >gb|AAA85364.1| chitinase [Picea glauca] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVNSRVNYYKKICSQLGVDPGANVSC 276 >gb|AEF59002.1| class IV chitinase [Picea engelmannii x Picea glauca] Length = 266 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 234 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 266 >gb|ACY06323.1| class IV chitinase 4-4 [Pseudotsuga menziesii] Length = 277 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 245 CNGGNSGEVSSRVNYYRKICSQLGVDPGANVSC 277 >gb|ACY06321.1| class IV chitinase 4-2 [Pseudotsuga menziesii] Length = 271 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 239 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 271 >gb|ACY06320.1| class II chitinase 4-1 [Pseudotsuga menziesii] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >pdb|3HBD|A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a gi|255917950|pdb|3HBE|X Chain X, Class Iv Chitinase Structure From Picea Abies At 1.55a gi|255917951|pdb|3HBH|A Chain A, Class Iv Chitinase Structure From Picea Abies At 2.25a Length = 204 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 172 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 204 >gb|ACP43362.1| class IV chitinase [Pseudotsuga menziesii] Length = 277 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 245 CNGGNSGEVSSRVNYYRKICSQLGVDPGANVSC 277 >gb|ACM89955.1| class IV chitinase Chia4-Pa1 variant [Picea abies] Length = 251 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 219 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 251 >gb|ACM89954.1| class IV chitinase Chia4-Pa2 variant [Picea abies] Length = 251 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 219 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 251 >gb|ABR17664.1| unknown [Picea sitchensis] Length = 117 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 85 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 117 >gb|ABK27070.1| unknown [Picea sitchensis] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|ABK21634.1| unknown [Picea sitchensis] gi|116781053|gb|ABK21945.1| unknown [Picea sitchensis] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|AAT09426.1| putative class IV chitanase [Picea abies] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|AAQ17050.1| class IV chitinase Chia4-Pa1 [Picea abies] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|AAQ17048.1| class IV chitinase Chia4-Pa1.3 [Picea abies] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|AAQ17049.1| class IV chitinase Chia4-Pa1.1 [Picea abies] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|AAQ17051.1| class IV chitinase Chia4-Pa2 [Picea abies] Length = 276 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+K CSQLGVDPG+NVSC Sbjct: 244 CNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276 >gb|ACY06325.1| class IV chitinase 4-6 [Pseudotsuga menziesii] Length = 169 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y K CSQLGVDPG+NVSC Sbjct: 137 CNGGNSGEVSSRVNYYNKICSQLGVDPGANVSC 169 >gb|ACY06324.1| class IV chitinase 4-5 [Pseudotsuga menziesii] Length = 181 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y K CSQLGVDPG+NVSC Sbjct: 149 CNGGNSGEVSSRVNYYNKICSQLGVDPGANVSC 181 >gb|AAL58877.1|AF457094_1 putative class IV chitinase, partial [Pinus elliottii var. elliottii] gi|18087425|gb|AAL58878.1|AF457095_1 putative class IV chitinase, partial [Pinus elliottii var. elliottii] Length = 52 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +2 Query: 2 CGGGNPSEVQSRVNFYQKFCSQLGVDPGSNVSC 100 C GGN EV SRVN+Y+ CSQLGVDPG+NVSC Sbjct: 20 CNGGNSGEVNSRVNYYKNICSQLGVDPGANVSC 52