BLASTX nr result
ID: Ephedra28_contig00010313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00010313 (799 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella t... 58 3e-06 gb|AHC94278.1| ribosomal protein S4, partial (mitochondrion) [Am... 57 1e-05 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 57 1e-05 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 57 1e-05 >gb|AHA47128.1| ribosomal protein S4 (mitochondrion) [Amborella trichopoda] Length = 354 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +3 Query: 531 KRKVQRIQLPTHYLEVNYRTMKAVVFDNPDFEFLPTQVKKALNNL 665 KR+++RI+LPTHYLEVNYRT+KAVVF PD +P ++ NL Sbjct: 289 KRRIKRIELPTHYLEVNYRTLKAVVFYGPDIGHIPHDIRLKDPNL 333 >gb|AHC94278.1| ribosomal protein S4, partial (mitochondrion) [Amborella trichopoda] Length = 324 Score = 56.6 bits (135), Expect = 1e-05 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +3 Query: 531 KRKVQRIQLPTHYLEVNYRTMKAVVFDNPDFEFLP 635 KR+++RI+LPTHYLEVNYRT+KAVVF PD +P Sbjct: 289 KRRIKRIELPTHYLEVNYRTLKAVVFYGPDIGHIP 323 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gi|357197350|gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 531 KRKVQRIQLPTHYLEVNYRTMKAVVFDNPDFEFLPTQVK-KALNNL 665 KR+++RI+LPTHYLEVNYRT+KAVVF P+ +P ++ K LN L Sbjct: 302 KRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLL 347 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|372450274|ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197313|gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gi|357197320|gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/46 (58%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +3 Query: 531 KRKVQRIQLPTHYLEVNYRTMKAVVFDNPDFEFLPTQVK-KALNNL 665 KR+++RI+LPTHYLEVNYRT+KAVVF P+ +P ++ K LN L Sbjct: 302 KRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLL 347