BLASTX nr result
ID: Ephedra28_contig00010249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00010249 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850987.1| hypothetical protein AMTR_s00025p00212090 [A... 61 1e-07 >ref|XP_006850987.1| hypothetical protein AMTR_s00025p00212090 [Amborella trichopoda] gi|548854658|gb|ERN12568.1| hypothetical protein AMTR_s00025p00212090 [Amborella trichopoda] Length = 906 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/103 (36%), Positives = 57/103 (55%), Gaps = 4/103 (3%) Frame = +3 Query: 3 QAWKSIPDP-EESSVENESSRKDKLGEENLKDQSSANNIRPKSK---FLRKNDGAVTESV 170 Q W+S+P P ++ E SS K+ L E N D S ++ K + LR+ G + Sbjct: 313 QYWRSLPSPCSPTASEVGSSTKENLCEGNSTDFGSVSDSGWKDRNDILLRRAGGPIANG- 371 Query: 171 PDYVSLAKKRAPLADKKTNIHLPKKTERAKSDNWHVEVAVPRA 299 L KKR PLAD+KT+ +L K+ K++ WHVE+A+P+A Sbjct: 372 -SGTRLVKKRTPLADRKTDQNLHDKSLHEKTNEWHVEIALPKA 413