BLASTX nr result
ID: Ephedra28_contig00009631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00009631 (740 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006957624.1| hypothetical protein WALSEDRAFT_60041 [Walle... 57 8e-06 >ref|XP_006957624.1| hypothetical protein WALSEDRAFT_60041 [Wallemia sebi CBS 633.66] gi|388582065|gb|EIM22371.1| hypothetical protein WALSEDRAFT_60041 [Wallemia sebi CBS 633.66] Length = 353 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +1 Query: 415 FKNEMDKHASDTSFEAYERVPVHQFGEAVLKSMGWNPDRAIGIRGGPPPLPYTVPVRASR 594 FK ++ A +++ + YERVPVHQFG A+L+ MGW A P PY R + Sbjct: 158 FKADVAARADESTIDEYERVPVHQFGAALLRGMGWKEGTAASRTRTGPTEPYLPDSRPAL 217 Query: 595 LGLGATLK 618 LG+GA+ + Sbjct: 218 LGIGASAR 225