BLASTX nr result
ID: Ephedra28_contig00008562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00008562 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842161.1| hypothetical protein AMTR_s00078p00141340 [A... 56 6e-06 >ref|XP_006842161.1| hypothetical protein AMTR_s00078p00141340 [Amborella trichopoda] gi|548844210|gb|ERN03836.1| hypothetical protein AMTR_s00078p00141340 [Amborella trichopoda] Length = 603 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -1 Query: 488 FCDACFSGKYPVLPXXXXXXXVGDFVDDGLSGTLEVGWNH 369 FC ACFSG YPV P +GDFVDDGLSG ++ GW H Sbjct: 560 FCYACFSGDYPVPPRDVKIKHLGDFVDDGLSGKVDEGWTH 599