BLASTX nr result
ID: Ephedra28_contig00008450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00008450 (592 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE77849.1| unknown [Picea sitchensis] 75 1e-11 ref|XP_006841435.1| hypothetical protein AMTR_s00003p00052150 [A... 75 2e-11 ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera... 57 4e-06 >gb|ADE77849.1| unknown [Picea sitchensis] Length = 563 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -3 Query: 587 PIILGALAIFVFVSMPRLKDAYNWAAGLTPSGNGTNPPKKDVRKPTIRKRTY 432 P+I+G L I VF SMPRL+DAY WA G PSG T PKKD+RK T+RKRTY Sbjct: 512 PLIVGVLVIAVFASMPRLRDAYQWAVGFAPSGMTTVAPKKDIRKLTVRKRTY 563 >ref|XP_006841435.1| hypothetical protein AMTR_s00003p00052150 [Amborella trichopoda] gi|548843456|gb|ERN03110.1| hypothetical protein AMTR_s00003p00052150 [Amborella trichopoda] Length = 1191 Score = 74.7 bits (182), Expect = 2e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = -3 Query: 587 PIILGALAIFVFVSMPRLKDAYNWAAGLTPSGNGTNPPKKDVRKPTIRKRTY 432 P+I+G I +F+SMPRLKD Y WAAG+ PSG+ PKK+VRKP IRKRTY Sbjct: 1140 PLIVGMAVIALFISMPRLKDLYQWAAGIAPSGSLATAPKKEVRKPIIRKRTY 1191 >ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera] gi|297743995|emb|CBI36965.3| unnamed protein product [Vitis vinifera] Length = 1199 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/52 (51%), Positives = 37/52 (71%) Frame = -3 Query: 587 PIILGALAIFVFVSMPRLKDAYNWAAGLTPSGNGTNPPKKDVRKPTIRKRTY 432 P+I+G I +F+SMPRLKD Y G++ SG T+ KK+VRKP +RK+TY Sbjct: 1149 PLIVGVSVIALFISMPRLKDLYQTTMGMSMSG-ATSTAKKEVRKPILRKKTY 1199