BLASTX nr result
ID: Ephedra28_contig00007395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00007395 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK25480.1| unknown [Picea sitchensis] 63 5e-08 gb|AEX12655.1| hypothetical protein 2_6031_01 [Pinus taeda] 60 3e-07 gb|AEX12654.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|3... 60 3e-07 ref|XP_006828037.1| hypothetical protein AMTR_s00008p00256490 [A... 59 9e-07 gb|ACN40797.1| unknown [Picea sitchensis] 56 6e-06 >gb|ABK25480.1| unknown [Picea sitchensis] Length = 460 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = -2 Query: 408 CLAMLPSSGMSVLGNVQQENFRMVYDSGNNVLSFSPTSC 292 CLAMLPS+GMS+ GN+QQ+N++++YD+ NVLSF+PT C Sbjct: 419 CLAMLPSNGMSIFGNIQQQNYQILYDNERNVLSFAPTVC 457 >gb|AEX12655.1| hypothetical protein 2_6031_01 [Pinus taeda] Length = 103 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 411 LCLAMLPSSGMSVLGNVQQENFRMVYDSGNNVLSFSPTSC 292 +CLAMLPSSGMS+ GN QQ+N+ ++YD+G N LSF+ T C Sbjct: 61 ICLAMLPSSGMSIFGNFQQQNYHILYDNGKNELSFTRTVC 100 >gb|AEX12654.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066755|gb|AEX12656.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066757|gb|AEX12657.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066759|gb|AEX12658.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066761|gb|AEX12659.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066763|gb|AEX12660.1| hypothetical protein 2_6031_01 [Pinus taeda] gi|367066765|gb|AEX12661.1| hypothetical protein 2_6031_01 [Pinus taeda] Length = 103 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 411 LCLAMLPSSGMSVLGNVQQENFRMVYDSGNNVLSFSPTSC 292 +CLAMLPSSGMS+ GN QQ+N+ ++YD+G N LSF+ T C Sbjct: 61 ICLAMLPSSGMSIFGNFQQQNYHILYDNGKNELSFTRTVC 100 >ref|XP_006828037.1| hypothetical protein AMTR_s00008p00256490 [Amborella trichopoda] gi|548832672|gb|ERM95453.1| hypothetical protein AMTR_s00008p00256490 [Amborella trichopoda] Length = 436 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 411 LCLAMLPSSGMSVLGNVQQENFRMVYDSGNNVLSFSPTSC 292 LCLAM+P+SGMS+LGNVQQ+NF + YD G +LSF+ C Sbjct: 394 LCLAMMPASGMSILGNVQQQNFLVQYDLGKELLSFTSAQC 433 >gb|ACN40797.1| unknown [Picea sitchensis] Length = 383 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/44 (52%), Positives = 37/44 (84%), Gaps = 4/44 (9%) Frame = -2 Query: 411 LCLAMLPSSG----MSVLGNVQQENFRMVYDSGNNVLSFSPTSC 292 +CLAM+P++ M++ GNVQQ+N++++YD+ NNVLSF+PT+C Sbjct: 337 VCLAMMPTNSNLGNMAIFGNVQQQNYQILYDNENNVLSFAPTAC 380