BLASTX nr result
ID: Ephedra28_contig00007289
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00007289 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327202.1| predicted protein [Populus trichocarpa] gi|5... 57 3e-06 gb|AFG65933.1| hypothetical protein CL1476Contig1_03, partial [P... 55 7e-06 >ref|XP_002327202.1| predicted protein [Populus trichocarpa] gi|566200905|ref|XP_006376368.1| hypothetical protein POPTR_0013s12430g [Populus trichocarpa] gi|550325644|gb|ERP54165.1| hypothetical protein POPTR_0013s12430g [Populus trichocarpa] Length = 676 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/140 (25%), Positives = 68/140 (48%), Gaps = 9/140 (6%) Frame = -2 Query: 396 EKVLGRVVDEYCSAHPVLHGLVQSVXXXXXXXXXXXXXXKVSVMLETEKNLDFTMSPVYS 217 E V+ V+D + + L ++ V V+ +++ EK D+T +P Y Sbjct: 471 EGVVISVLDRHSENYHQLQLFIRRVAHKLVAKMKDRSIDWVTEIVQMEKETDYTCNPEYM 530 Query: 216 DTYGNFLASKYQVLKQIRK---------EGSGTVSLSHVKELRLLGPECLEAAYEMWMSV 64 + +A ++ V++ I + EG G V + H+ E +L+ P+ A+++ M V Sbjct: 531 KEWNKLMAQQHTVIEDIMQRGRYYLVKIEGFGDVKVGHLMEYKLILPK----AFDLKMRV 586 Query: 63 ASYWEVVTLRIGDGIPLMLQ 4 +YW+VV +R+ D + L LQ Sbjct: 587 TAYWKVVLMRLVDNMALHLQ 606 >gb|AFG65933.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166028|gb|AFG65934.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166030|gb|AFG65935.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166032|gb|AFG65936.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166034|gb|AFG65937.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166036|gb|AFG65938.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166038|gb|AFG65939.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166040|gb|AFG65940.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166042|gb|AFG65941.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166044|gb|AFG65942.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166046|gb|AFG65943.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166048|gb|AFG65944.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166050|gb|AFG65945.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166052|gb|AFG65946.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] gi|383166054|gb|AFG65947.1| hypothetical protein CL1476Contig1_03, partial [Pinus taeda] Length = 68 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 105 PECLEAAYEMWMSVASYWEVVTLRIGDGIPLMLQF 1 PE L AAY+M MSV +YW VVTLR+GDGIPL LQF Sbjct: 3 PERLVAAYDMQMSVMAYWRVVTLRMGDGIPLRLQF 37