BLASTX nr result
ID: Ephedra28_contig00006614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00006614 (942 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542777.1| PREDICTED: SUN domain-containing protein 1-l... 58 5e-06 >ref|XP_003542777.1| PREDICTED: SUN domain-containing protein 1-like [Glycine max] Length = 464 Score = 58.2 bits (139), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 5 LVNMIKLDVLSNHGSSSHTCIYRFRVHGSEPE 100 ++NM++LD SNHGS SHTCIYRFRVHG EP+ Sbjct: 424 VINMVRLDFTSNHGSPSHTCIYRFRVHGHEPD 455