BLASTX nr result
ID: Ephedra28_contig00006442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00006442 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23062.1| unknown [Picea sitchensis] 63 4e-08 >gb|ABK23062.1| unknown [Picea sitchensis] Length = 222 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +3 Query: 159 EQKPVERKEFQVFWEPLR-AGSKYRDESKVQEEIPMRVPYPMPECSNGVANDLKLSIFKD 335 E KP+ KEFQVFWEPLR A S R+E+ E + P P V +DL LSIFKD Sbjct: 142 ETKPLVTKEFQVFWEPLRTAASAGREEAPTMSETAKKKPPPPL-----VESDLNLSIFKD 196 Query: 336 IPNSFVVPGR 365 +PN F++P R Sbjct: 197 VPNGFLLPNR 206