BLASTX nr result
ID: Ephedra28_contig00006377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00006377 (579 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006582257.1| PREDICTED: micronuclear linker histone polyp... 58 2e-06 gb|ESW04927.1| hypothetical protein PHAVU_011G137100g [Phaseolus... 58 2e-06 >ref|XP_006582257.1| PREDICTED: micronuclear linker histone polyprotein-like [Glycine max] Length = 568 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = -1 Query: 426 DRWSFLEGMDAPKWADLSLEGRIRMETCNDDSWFETVHPCHQLSLKELVS 277 D W+FLE ++AP W DL+LE + DD WF T HP HQ+S +EL S Sbjct: 16 DPWAFLEHIEAPMWVDLTLEVKSGCVDTGDDEWFNTSHPFHQMSARELKS 65 >gb|ESW04927.1| hypothetical protein PHAVU_011G137100g [Phaseolus vulgaris] Length = 481 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -1 Query: 450 GLSTVIDNDRWSFLEGMDAPKWADLSLEG-RIRMETCNDDSWFETVHPCHQLSLKELVS 277 G++ ND W+FLE ++AP W DL++E + T +DD WF T HP HQ+S +EL S Sbjct: 8 GVAIKKTNDNWAFLEHIEAPMWVDLAVEAVSGGVGTGDDDDWFNTSHPFHQMSARELKS 66