BLASTX nr result
ID: Ephedra28_contig00005799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00005799 (448 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW09204.1| hypothetical protein CL4686Contig1_05, partial [P... 67 2e-09 >gb|AEW09204.1| hypothetical protein CL4686Contig1_05, partial [Pinus radiata] gi|383151883|gb|AFG57997.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151885|gb|AFG57998.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151887|gb|AFG57999.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151889|gb|AFG58000.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151891|gb|AFG58001.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151893|gb|AFG58002.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151895|gb|AFG58003.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151897|gb|AFG58004.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151899|gb|AFG58005.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151901|gb|AFG58006.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151903|gb|AFG58007.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151905|gb|AFG58008.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151907|gb|AFG58009.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151909|gb|AFG58010.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151911|gb|AFG58011.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151913|gb|AFG58012.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151915|gb|AFG58013.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] gi|383151917|gb|AFG58014.1| hypothetical protein CL4686Contig1_05, partial [Pinus taeda] Length = 69 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 2 YSVSFTASPNANKGYAFGSLTWSDGKHSVRTPFVVNVS 115 YSV FTAS NA+KGYAFGS+TW+DG H+VRTPF VN+S Sbjct: 32 YSVMFTASGNASKGYAFGSITWADGTHNVRTPFAVNIS 69