BLASTX nr result
ID: Ephedra28_contig00005544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00005544 (653 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841789.1| hypothetical protein AMTR_s00003p00267250 [A... 57 4e-06 >ref|XP_006841789.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda] gi|548843810|gb|ERN03464.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda] Length = 1232 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +1 Query: 409 AGQRSCLEEMLETLRGIDEIPYDVPPALPTRPKSKARLPSKVKSRKGM 552 +G RS LEEML++++ DE D PPALP RP SKARLPS +++R+ + Sbjct: 5 SGTRSSLEEMLDSIKKRDERSKDTPPALPVRPTSKARLPSSIQTRRSL 52