BLASTX nr result
ID: Ephedra28_contig00005075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00005075 (819 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001170119.1| hypothetical protein Rsph17025_3960 [Rhodoba... 64 8e-08 ref|YP_003489928.1| hypothetical protein SCAB_43131 [Streptomyce... 63 1e-07 ref|YP_004075699.1| hypothetical protein Mspyr1_11820 [Mycobacte... 60 7e-07 ref|YP_001133066.1| hypothetical protein Mflv_1798 [Mycobacteriu... 60 7e-07 ref|WP_007028173.1| hypothetical protein [Amycolatopsis decaplan... 60 9e-07 ref|WP_003564291.1| hypothetical protein [Rhizobium leguminosaru... 60 9e-07 gb|AHG45794.1| hypothetical protein RLEG12_22265 [Rhizobium legu... 60 1e-06 ref|WP_007629659.1| hypothetical protein [Rhizobium sp. CCGE 510... 60 1e-06 ref|YP_007037963.1| hypothetical protein BN6_37990 [Saccharothri... 59 2e-06 gb|AHF84435.1| hypothetical protein RLEG3_22605 [Rhizobium legum... 59 2e-06 ref|WP_020113644.1| hypothetical protein [Streptomyces bottropen... 59 2e-06 ref|YP_008906616.1| hypothetical protein D174_10625 [Mycobacteri... 59 2e-06 ref|YP_674971.1| hypothetical protein Meso_2422 [Chelativorans s... 59 3e-06 ref|YP_008014185.1| hypothetical protein AORI_5198 [Amycolatopsi... 59 3e-06 ref|WP_003579907.1| hypothetical protein [Rhizobium leguminosaru... 58 4e-06 ref|WP_008535203.1| hypothetical protein [Rhizobium sp. Pop5] gi... 58 5e-06 ref|YP_008713097.1| hypothetical protein GKIL_3144 [Gloeobacter ... 57 6e-06 ref|WP_022879506.1| hypothetical protein [Microbacterium sp. B19] 57 6e-06 ref|YP_008389896.1| hypothetical protein B446_31405 [Streptomyce... 57 6e-06 ref|WP_020075491.1| hypothetical protein [Cryocola sp. 340MFSha3.1] 57 6e-06 >ref|YP_001170119.1| hypothetical protein Rsph17025_3960 [Rhodobacter sphaeroides ATCC 17025] gi|500250494|ref|WP_011910836.1| hypothetical protein [Rhodobacter sphaeroides] gi|145558202|gb|ABP72814.1| hypothetical protein Rsph17025_3960 [Rhodobacter sphaeroides ATCC 17025] Length = 69 Score = 63.5 bits (153), Expect = 8e-08 Identities = 28/67 (41%), Positives = 43/67 (64%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M ++L G +VAW GE +G+IV+K T++ K+ AS D+P+Y+++SDKT + Sbjct: 1 MAKELRQGDKVAWNTSWGETEGRIVKKQTRDTKIKGHKVSASPDDPQYVVQSDKTGAKAA 60 Query: 522 RKPQVLR 502 KPQ LR Sbjct: 61 HKPQALR 67 >ref|YP_003489928.1| hypothetical protein SCAB_43131 [Streptomyces scabiei 87.22] gi|502767010|ref|WP_013001994.1| hypothetical protein [Streptomyces scabiei] gi|260648272|emb|CBG71383.1| conserved hypothetical protein [Streptomyces scabiei 87.22] Length = 140 Score = 63.2 bits (152), Expect = 1e-07 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 6/91 (6%) Frame = -1 Query: 759 QTIGGNNRKNVRR------RMASGRMQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLN 598 + + G+ R+ R RMA R R G RVAWR EA GK+ +K+T+ + Sbjct: 47 RVVSGHFRRGTRELTDRRCRMAGKRQPRK---GDRVAWRSHGSEATGKVEKKITERTEAA 103 Query: 597 SKTYKASQDEPRYLIRSDKTDKEFIRKPQVL 505 +T +AS ++P+YL+RSDK+ + + +PQ L Sbjct: 104 GRTVEASAEDPQYLVRSDKSGRTAVHRPQAL 134 >ref|YP_004075699.1| hypothetical protein Mspyr1_11820 [Mycobacterium gilvum Spyr1] gi|503236229|ref|WP_013470890.1| hypothetical protein [Mycobacterium gilvum] gi|315261123|gb|ADT97864.1| hypothetical protein Mspyr1_11820 [Mycobacterium gilvum Spyr1] Length = 76 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/65 (36%), Positives = 42/65 (64%) Frame = -1 Query: 696 RDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFIRK 517 R+ + G +V W+ +G + +K+T + + +T +AS++EP+YL+RSDKT K+ + K Sbjct: 10 RNFKKGDKVTWQSHGNPVEGTVEKKITADTEAGGRTVRASEEEPQYLVRSDKTGKDAVHK 69 Query: 516 PQVLR 502 P LR Sbjct: 70 PDALR 74 >ref|YP_001133066.1| hypothetical protein Mflv_1798 [Mycobacterium gilvum PYR-GCK] gi|500222588|ref|WP_011892689.1| hypothetical protein [Mycobacterium gilvum] gi|145214874|gb|ABP44278.1| conserved hypothetical protein [Mycobacterium gilvum PYR-GCK] Length = 70 Score = 60.5 bits (145), Expect = 7e-07 Identities = 24/65 (36%), Positives = 42/65 (64%) Frame = -1 Query: 696 RDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFIRK 517 R+ + G +V W+ +G + +K+T + + +T +AS++EP+YL+RSDKT K+ + K Sbjct: 4 RNFKKGDKVTWQSHGNPVEGTVEKKITADTEAGGRTVRASEEEPQYLVRSDKTGKDAVHK 63 Query: 516 PQVLR 502 P LR Sbjct: 64 PDALR 68 >ref|WP_007028173.1| hypothetical protein [Amycolatopsis decaplanina] gi|452959887|gb|EME65218.1| hypothetical protein H074_01122 [Amycolatopsis decaplanina DSM 44594] Length = 69 Score = 60.1 bits (144), Expect = 9e-07 Identities = 24/69 (34%), Positives = 45/69 (65%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + G +V W G+A+G++++++T + + +T +AS++EP+YL+RSDK+ E + Sbjct: 1 MTKRFRKGDKVRWNSHGGQAEGEVLKEITSDTEAGGRTVRASKEEPQYLVRSDKSGGEAV 60 Query: 522 RKPQVLRIL 496 KP+ L L Sbjct: 61 HKPEALEKL 69 >ref|WP_003564291.1| hypothetical protein [Rhizobium leguminosarum] gi|393176535|gb|EJC76576.1| Protein of unknown function (DUF2945) [Rhizobium leguminosarum bv. trifolii WSM2012] Length = 69 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/69 (40%), Positives = 41/69 (59%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + LEAG V+W G+ +GK++ K T+E K+ KAS P+Y+++SDK+ K Sbjct: 1 MSKQLEAGDEVSWDTSRGKTRGKVIRKQTRETKIKGHEVKASAALPQYIVKSDKSGKRAA 60 Query: 522 RKPQVLRIL 496 KP LR L Sbjct: 61 HKPGELRKL 69 >gb|AHG45794.1| hypothetical protein RLEG12_22265 [Rhizobium leguminosarum bv. trifolii CB782] Length = 69 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + LE G V+W G+ KGK++ K T+E K+ KAS P+Y+++SDK+ K Sbjct: 1 MSKQLEGGDEVSWDTSRGKTKGKVIRKQTRETKIKGHEVKASAALPQYIVKSDKSGKRAA 60 Query: 522 RKPQVLRIL 496 KP LR L Sbjct: 61 HKPGELRKL 69 >ref|WP_007629659.1| hypothetical protein [Rhizobium sp. CCGE 510] gi|401813295|gb|EJT05642.1| hypothetical protein RCCGE510_10445 [Rhizobium sp. CCGE 510] Length = 69 Score = 59.7 bits (143), Expect = 1e-06 Identities = 27/69 (39%), Positives = 42/69 (60%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + L+ G V+W G+ +G++V+K T + K+ T KAS EP+Y++ SDK+ K Sbjct: 1 MSKQLKKGDDVSWDTSQGKTEGRVVKKQTSQTKIKGHTVKASAAEPQYIVESDKSGKRAA 60 Query: 522 RKPQVLRIL 496 KP+ LR L Sbjct: 61 HKPEELRKL 69 >ref|YP_007037963.1| hypothetical protein BN6_37990 [Saccharothrix espanaensis DSM 44229] gi|504914100|ref|WP_015101202.1| hypothetical protein [Saccharothrix espanaensis] gi|407883447|emb|CCH31090.1| hypothetical protein BN6_37990 [Saccharothrix espanaensis DSM 44229] Length = 101 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/69 (36%), Positives = 42/69 (60%) Frame = -1 Query: 708 GRMQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKE 529 G ++L G VAW G++VEK+T++ + + +AS+DEP+Y +RSDK+ K+ Sbjct: 30 GMGDKELHKGDEVAWSSHGQTVHGEVVEKITEDTEAAGRQVRASEDEPQYRVRSDKSGKD 89 Query: 528 FIRKPQVLR 502 + KP L+ Sbjct: 90 AVHKPSALK 98 >gb|AHF84435.1| hypothetical protein RLEG3_22605 [Rhizobium leguminosarum bv. trifolii WSM1689] Length = 69 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + L++G+ V+W G+ KG+++ K T + K+ KAS EP+Y++ SDK+ K Sbjct: 1 MAKQLKSGEEVSWDTSQGKIKGRVIRKQTSQTKIKGHKVKASAAEPQYIVESDKSGKRAA 60 Query: 522 RKPQVLRIL 496 KP LR L Sbjct: 61 HKPDELRKL 69 >ref|WP_020113644.1| hypothetical protein [Streptomyces bottropensis] Length = 76 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/66 (37%), Positives = 41/66 (62%) Frame = -1 Query: 699 QRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFIR 520 +R G RV+W+ E GK+ +K+T+ + +T AS ++P+YL+RSDK+ + + Sbjct: 4 KRQPRKGDRVSWKSHGSETTGKVEKKITERTEAAGRTVDASAEDPQYLVRSDKSGRTAVH 63 Query: 519 KPQVLR 502 KPQ LR Sbjct: 64 KPQALR 69 >ref|YP_008906616.1| hypothetical protein D174_10625 [Mycobacterium neoaurum VKM Ac-1815D] gi|518343363|ref|WP_019513570.1| hypothetical protein [Mycobacterium neoaurum] gi|565685145|gb|AHC25005.1| hypothetical protein D174_10625 [Mycobacterium neoaurum VKM Ac-1815D] Length = 71 Score = 58.9 bits (141), Expect = 2e-06 Identities = 23/67 (34%), Positives = 44/67 (65%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M ++L+ G +V+W+ G + +K+T + + +T +A++DEP+Y +RSDKT K+ + Sbjct: 1 MSKELKKGDKVSWQSHGNTVPGTVEKKITSDTETAGRTVRATKDEPQYKVRSDKTGKDAV 60 Query: 522 RKPQVLR 502 KP+ L+ Sbjct: 61 HKPESLK 67 >ref|YP_674971.1| hypothetical protein Meso_2422 [Chelativorans sp. BNC1] gi|499901013|ref|WP_011581747.1| hypothetical protein [Chelativorans sp. BNC1] gi|110285747|gb|ABG63806.1| conserved hypothetical protein [Chelativorans sp. BNC1] Length = 70 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/67 (38%), Positives = 41/67 (61%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + + G +V+W GE GK+V+K T E + S AS+D+P+Y+++SDK+ K+ Sbjct: 1 MTKSFKKGDKVSWDTSQGETHGKVVKKQTSETYIKSHKVAASKDDPQYIVQSDKSGKKAA 60 Query: 522 RKPQVLR 502 KP LR Sbjct: 61 HKPTELR 67 >ref|YP_008014185.1| hypothetical protein AORI_5198 [Amycolatopsis orientalis HCCB10007] gi|511268341|ref|WP_016335523.1| hypothetical protein [Amycolatopsis orientalis] gi|505817859|gb|AGM07782.1| hypothetical protein AORI_5198 [Amycolatopsis orientalis HCCB10007] Length = 69 Score = 58.5 bits (140), Expect = 3e-06 Identities = 23/69 (33%), Positives = 44/69 (63%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + G +V W G A+G++++++T + + +T +AS+++P+YL+RSDK+ E + Sbjct: 1 MSKRFRKGDKVRWNSHGGHAEGEVLKEITSDTEAGGRTVRASKEQPQYLVRSDKSGGEAV 60 Query: 522 RKPQVLRIL 496 KP+ L L Sbjct: 61 HKPEALEKL 69 >ref|WP_003579907.1| hypothetical protein [Rhizobium leguminosarum] gi|393179667|gb|EJC79706.1| Protein of unknown function (DUF2945) [Rhizobium leguminosarum bv. trifolii WSM2297] Length = 69 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/67 (38%), Positives = 39/67 (58%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M + L+ G V+W GE +G++V+K T K+ + KAS EP+Y++ SDK+ K Sbjct: 1 MSKQLKTGDEVSWDTSQGETEGRVVKKQTSPTKIKGQKVKASVAEPQYIVESDKSGKRAA 60 Query: 522 RKPQVLR 502 KP LR Sbjct: 61 HKPDELR 67 >ref|WP_008535203.1| hypothetical protein [Rhizobium sp. Pop5] gi|403700261|gb|EJZ17478.1| hypothetical protein RCCGEPOP_30509 [Rhizobium sp. Pop5] Length = 69 Score = 57.8 bits (138), Expect = 5e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M R L+ G V+W G+ +G++V K T E K+ KAS EP+Y++ SDK+ K Sbjct: 1 MSRQLKPGDHVSWDTSQGKTEGRVVWKQTSETKIKRHKVKASAAEPQYIVESDKSGKRAA 60 Query: 522 RKPQVLRIL 496 KP LR L Sbjct: 61 HKPHELRNL 69 >ref|YP_008713097.1| hypothetical protein GKIL_3144 [Gloeobacter kilaueensis JS1] gi|554673178|ref|WP_023174650.1| hypothetical protein [Gloeobacter kilaueensis] gi|553883948|gb|AGY59390.1| hypothetical protein GKIL_3144 [Gloeobacter kilaueensis JS1] Length = 74 Score = 57.4 bits (137), Expect = 6e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M L+ G RV W G + GKI +KLT + AS++EP+YL+ SDKT +E Sbjct: 1 MSDTLKVGDRVEWHSSGGTSIGKIKQKLTSPTHIKDHKVNASEEEPQYLVVSDKTGEEAA 60 Query: 522 RKPQVLRIL 496 KP+ L+ L Sbjct: 61 HKPEALKKL 69 >ref|WP_022879506.1| hypothetical protein [Microbacterium sp. B19] Length = 71 Score = 57.4 bits (137), Expect = 6e-06 Identities = 26/69 (37%), Positives = 42/69 (60%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M +DL G RV+W G +G++VEK T++ + + + + AS+DEP Y+++S+KTD Sbjct: 1 MSKDLSKGDRVSWDTPQGRTQGEVVEKKTKDFQHDGQKFTASEDEPAYIVKSEKTDATAA 60 Query: 522 RKPQVLRIL 496 K L L Sbjct: 61 HKGSALNKL 69 >ref|YP_008389896.1| hypothetical protein B446_31405 [Streptomyces collinus Tu 365] gi|529246126|ref|WP_020943495.1| hypothetical protein [Streptomyces collinus] gi|529201339|gb|AGS73085.1| hypothetical protein B446_31405 [Streptomyces collinus Tu 365] Length = 76 Score = 57.4 bits (137), Expect = 6e-06 Identities = 24/65 (36%), Positives = 41/65 (63%) Frame = -1 Query: 696 RDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFIRK 517 ++L+ G V WR G+A+GK+ +K+T+ + +T AS +EP+Y +RSDK+ + K Sbjct: 9 KELKKGDDVTWRSHGGQAEGKVEKKITERTEAAGRTVDASPEEPQYQVRSDKSGGSAVHK 68 Query: 516 PQVLR 502 P L+ Sbjct: 69 PSALK 73 >ref|WP_020075491.1| hypothetical protein [Cryocola sp. 340MFSha3.1] Length = 70 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/66 (37%), Positives = 41/66 (62%) Frame = -1 Query: 702 MQRDLEAGQRVAWRFGAGEAKGKIVEKLTQEKKLNSKTYKASQDEPRYLIRSDKTDKEFI 523 M +L+ G V W + G++ +KLT + + +T +AS+D+P+YL++SDKT KE + Sbjct: 1 MADELKHGDHVEWSSHGVDVPGEVEKKLTDDTEAAGRTVRASKDDPQYLVKSDKTGKEAV 60 Query: 522 RKPQVL 505 KP L Sbjct: 61 HKPDAL 66