BLASTX nr result
ID: Ephedra28_contig00004643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00004643 (509 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850021.1| hypothetical protein AMTR_s00022p00186920 [A... 58 1e-06 >ref|XP_006850021.1| hypothetical protein AMTR_s00022p00186920 [Amborella trichopoda] gi|548853619|gb|ERN11602.1| hypothetical protein AMTR_s00022p00186920 [Amborella trichopoda] Length = 145 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +1 Query: 187 STASSAQEIDKLAEDFIESFYEKMRLEKQHSYKRYEEMLTRGV 315 + AS +EID+LAE FI +F+EK RLEKQ SY+RY++ML R + Sbjct: 103 AAASEVEEIDRLAEKFIATFHEKFRLEKQESYRRYQDMLARSI 145