BLASTX nr result
ID: Ephedra28_contig00004319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00004319 (573 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003696397.1| coagulation factor 5/8 type domain-containin... 55 1e-05 >ref|YP_003696397.1| coagulation factor 5/8 type domain-containing protein [Arcanobacterium haemolyticum DSM 20595] gi|502934300|ref|WP_013169276.1| coagulation factor 5/8 type domain-containing protein [Arcanobacterium haemolyticum] gi|296930970|gb|ADH91778.1| coagulation factor 5/8 type domain protein [Arcanobacterium haemolyticum DSM 20595] Length = 982 Score = 55.5 bits (132), Expect = 1e-05 Identities = 31/113 (27%), Positives = 63/113 (55%) Frame = -3 Query: 526 NMDSDTMDLLTAQLVTLREELEEAKYKEKILQKEKQDSERAFEALEMNIFQITAQAGKDR 347 N D ++ L A L ++L++A +++ +K+++E A + + ++ +I + K + Sbjct: 792 NEDLKKIEKLEADKAELEKKLDQATKDKEVALTKKKEAEDAAQKAKESLTKINDELAKLQ 851 Query: 346 ISFEEAQEESVNLRAEIEELRAINKKIEAQLNQAKMEAESAKAELEKHKRDEK 188 +E+A + L+ +I+ L + +E Q+N AK E E AK +LE+ K+D K Sbjct: 852 KEYEKAIDGKEALKTKIDTLNKQRQNLENQINTAKTELEKAKKQLEEAKKDPK 904