BLASTX nr result
ID: Ephedra28_contig00003942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00003942 (842 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852561.1| hypothetical protein AMTR_s00021p00200510 [A... 58 4e-06 >ref|XP_006852561.1| hypothetical protein AMTR_s00021p00200510 [Amborella trichopoda] gi|548856172|gb|ERN14028.1| hypothetical protein AMTR_s00021p00200510 [Amborella trichopoda] Length = 330 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = +3 Query: 219 MARVNKFNPINLNDLYGKKEPSVKPAATSSSSAIRPKLAGHGGMLVLSRPVKQQP 383 MAR+NK+ IN N++YG K P+ P + SS + RP A HGGMLVL+RP K QP Sbjct: 1 MARINKYASINFNEVYGNKNPA--PNSVSSPATSRP--ASHGGMLVLTRPSKPQP 51