BLASTX nr result
ID: Ephedra28_contig00002907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00002907 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610465.1| hypothetical protein MTR_4g132450 [Medicago ... 56 6e-06 >ref|XP_003610465.1| hypothetical protein MTR_4g132450 [Medicago truncatula] gi|357497989|ref|XP_003619283.1| hypothetical protein MTR_6g045690 [Medicago truncatula] gi|355494298|gb|AES75501.1| hypothetical protein MTR_6g045690 [Medicago truncatula] gi|355511520|gb|AES92662.1| hypothetical protein MTR_4g132450 [Medicago truncatula] Length = 333 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/60 (45%), Positives = 34/60 (56%) Frame = -3 Query: 376 LCLCKDGNSTTYCNDSSHFHYRHKSHAGVIAGTLTXXXXXXXXXXXXXFWYLRKRRANQP 197 LCLCK+GN TT+CND H + RH + VIAGT+T WYL+K +A P Sbjct: 263 LCLCKEGNFTTHCND--HENARHSRNVHVIAGTVTAISAFGALGIGGGIWYLKKMKAKAP 320