BLASTX nr result
ID: Ephedra28_contig00002891
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00002891 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003575042.1| PREDICTED: elongation factor 2-like [Brachyp... 56 4e-06 gb|EXB53386.1| Elongation factor 2 [Morus notabilis] 55 1e-05 >ref|XP_003575042.1| PREDICTED: elongation factor 2-like [Brachypodium distachyon] Length = 843 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 315 MVKFTAEELRRIMDKKNNIRNMSVIAH 395 MVKFTAEELRRIMDKKNNIRNMSVIAH Sbjct: 1 MVKFTAEELRRIMDKKNNIRNMSVIAH 27 >gb|EXB53386.1| Elongation factor 2 [Morus notabilis] Length = 881 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 276 YLISCD*KYKPVKMVKFTAEELRRIMDKKNNIRNMSVIAH 395 ++ CD + VKMVKFTAEELR+IMD K+NIRNMSVIAH Sbjct: 27 FIFVCD-TQRLVKMVKFTAEELRKIMDYKHNIRNMSVIAH 65