BLASTX nr result
ID: Ephedra28_contig00002237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00002237 (709 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382471.1| hypothetical protein POPTR_0005s02450g [Popu... 61 3e-07 ref|XP_006382470.1| hypothetical protein POPTR_0005s02450g [Popu... 61 3e-07 ref|XP_006375743.1| hypothetical protein POPTR_0013s01700g [Popu... 61 3e-07 ref|XP_006375742.1| hypothetical protein POPTR_0013s01700g [Popu... 61 3e-07 ref|XP_006848393.1| hypothetical protein AMTR_s00013p00217480 [A... 61 3e-07 gb|EMJ06852.1| hypothetical protein PRUPE_ppa009360mg [Prunus pe... 61 3e-07 gb|EMJ06851.1| hypothetical protein PRUPE_ppa009360mg [Prunus pe... 61 3e-07 ref|XP_002330215.1| predicted protein [Populus trichocarpa] 61 3e-07 gb|EOX95073.1| RNA-binding family protein isoform 3 [Theobroma c... 61 4e-07 gb|EOX95072.1| RNA-binding family protein isoform 2 [Theobroma c... 61 4e-07 gb|EOX95071.1| RNA-binding family protein isoform 1 [Theobroma c... 61 4e-07 ref|XP_004157245.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 61 4e-07 ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 61 4e-07 ref|XP_004135598.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 61 4e-07 gb|ESW16947.1| hypothetical protein PHAVU_007G197400g [Phaseolus... 60 7e-07 gb|ESW16946.1| hypothetical protein PHAVU_007G197400g [Phaseolus... 60 7e-07 ref|XP_004984425.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 60 7e-07 ref|XP_004984424.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 60 7e-07 gb|EOY11517.1| RNA-binding family protein isoform 4 [Theobroma c... 60 7e-07 gb|EOY11516.1| RNA-binding family protein isoform 3 [Theobroma c... 60 7e-07 >ref|XP_006382471.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] gi|550337832|gb|ERP60268.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] Length = 283 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAYIRV+EY Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREY 186 >ref|XP_006382470.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] gi|550337831|gb|ERP60267.1| hypothetical protein POPTR_0005s02450g [Populus trichocarpa] Length = 264 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAYIRV+EY Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREY 186 >ref|XP_006375743.1| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] gi|566198865|ref|XP_002318990.2| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] gi|550324708|gb|ERP53540.1| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] gi|550324709|gb|EEE94913.2| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] Length = 296 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAYIRV+EY Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREY 186 >ref|XP_006375742.1| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] gi|550324707|gb|ERP53539.1| hypothetical protein POPTR_0013s01700g [Populus trichocarpa] Length = 260 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAYIRV+EY Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREY 186 >ref|XP_006848393.1| hypothetical protein AMTR_s00013p00217480 [Amborella trichopoda] gi|548851699|gb|ERN09974.1| hypothetical protein AMTR_s00013p00217480 [Amborella trichopoda] Length = 281 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF+RAYIRVKEY Sbjct: 156 YDDMKYAIRKLDDSEFRNAFSRAYIRVKEY 185 >gb|EMJ06852.1| hypothetical protein PRUPE_ppa009360mg [Prunus persica] Length = 295 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDMRYAI+KLDDSEF+NAF+RAYIRVKEY Sbjct: 158 YDDMRYAIRKLDDSEFKNAFSRAYIRVKEY 187 >gb|EMJ06851.1| hypothetical protein PRUPE_ppa009360mg [Prunus persica] Length = 270 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDMRYAI+KLDDSEF+NAF+RAYIRVKEY Sbjct: 158 YDDMRYAIRKLDDSEFKNAFSRAYIRVKEY 187 >ref|XP_002330215.1| predicted protein [Populus trichocarpa] Length = 226 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAYIRV+EY Sbjct: 157 YDDMKYAIKKLDDSEFRNAFSRAYIRVREY 186 >gb|EOX95073.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 268 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAY+RV+EY Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >gb|EOX95072.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 309 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAY+RV+EY Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >gb|EOX95071.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 353 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAY+RV+EY Sbjct: 156 YDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_004157245.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 322 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF+RAY+RVKEY Sbjct: 156 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEY 185 >ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] gi|449498497|ref|XP_004160553.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 309 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDDSEFRNAF+RAY+RV+EY Sbjct: 158 YDDMKYAIKKLDDSEFRNAFSRAYVRVREY 187 >ref|XP_004135598.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 315 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF+RAY+RVKEY Sbjct: 149 YDDMKYAIRKLDDSEFRNAFSRAYVRVKEY 178 >gb|ESW16947.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] Length = 277 Score = 60.1 bits (144), Expect = 7e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF+RAYIRV+EY Sbjct: 158 YDDMKYAIRKLDDSEFRNAFSRAYIRVREY 187 >gb|ESW16946.1| hypothetical protein PHAVU_007G197400g [Phaseolus vulgaris] Length = 268 Score = 60.1 bits (144), Expect = 7e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF+RAYIRV+EY Sbjct: 158 YDDMKYAIRKLDDSEFRNAFSRAYIRVREY 187 >ref|XP_004984425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Setaria italica] Length = 295 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDD+EFRNAF RAYIRVKEY Sbjct: 170 YDDMKYAIKKLDDTEFRNAFGRAYIRVKEY 199 >ref|XP_004984424.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Setaria italica] Length = 297 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAIKKLDD+EFRNAF RAYIRVKEY Sbjct: 170 YDDMKYAIKKLDDTEFRNAFGRAYIRVKEY 199 >gb|EOY11517.1| RNA-binding family protein isoform 4 [Theobroma cacao] Length = 303 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF RAYIRVKEY Sbjct: 155 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEY 184 >gb|EOY11516.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 271 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 YDDMRYAIKKLDDSEFRNAFTRAYIRVKEY 90 YDDM+YAI+KLDDSEFRNAF RAYIRVKEY Sbjct: 156 YDDMKYAIRKLDDSEFRNAFGRAYIRVKEY 185