BLASTX nr result
ID: Ephedra28_contig00002086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00002086 (628 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR16884.1| unknown [Picea sitchensis] 62 2e-07 gb|ACA04882.1| putative CCCH-type zinc finger protein [Picea abies] 57 3e-06 >gb|ABR16884.1| unknown [Picea sitchensis] Length = 581 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/58 (50%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 220 SEFHNGFDDLYRVDEEPVQRVESGRDLRAKIYARLAAQNNPDLDS-TPDLAWVNELVQ 390 S + ++ + EEP+QRVESGR+LRAKIY+RL+ +N ++++ +PDL WVNELV+ Sbjct: 524 SRWEKNWESDFFAQEEPLQRVESGRELRAKIYSRLSRENPDNINAESPDLGWVNELVK 581 >gb|ACA04882.1| putative CCCH-type zinc finger protein [Picea abies] Length = 97 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 4/47 (8%) Frame = +1 Query: 262 EEPVQRVESGRDLRAKIYARLAAQN----NPDLDSTPDLAWVNELVQ 390 EEPVQRVESG+DLRAKIYARL +N + +PD+ WVNELV+ Sbjct: 51 EEPVQRVESGKDLRAKIYARLTRENVLQDSSSSVESPDVGWVNELVK 97