BLASTX nr result
ID: Ephedra28_contig00001950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00001950 (899 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503501.1| PREDICTED: uncharacterized protein LOC101489... 57 7e-06 >ref|XP_004503501.1| PREDICTED: uncharacterized protein LOC101489321 [Cicer arietinum] Length = 423 Score = 57.4 bits (137), Expect = 7e-06 Identities = 35/75 (46%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Frame = -3 Query: 234 GEWLILRPDGKSR-DSWKSWGCLEALRERGSSGGFGTQV*THCRC**PDGKMQCSIVSGV 58 G WLILRP+G S SWK WG LEA RERGS G G +V +G + ++ Sbjct: 273 GAWLILRPNGASTVSSWKPWGRLEAWRERGSIDGLGYKVELFS----DNGPVNAITIAEG 328 Query: 57 HNQCTKGGKFIIDSA 13 KGGKF IDSA Sbjct: 329 TMSVKKGGKFCIDSA 343