BLASTX nr result
ID: Ephedra28_contig00001861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00001861 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW08200.1| hypothetical protein 2_2931_01, partial [Pinus la... 55 7e-06 >gb|AEW08200.1| hypothetical protein 2_2931_01, partial [Pinus lambertiana] Length = 151 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 470 HSGNGCPSAFALPGSPLSILQSSVDAKLQAICQRLSQEH 354 +S NG P+ + PG+ LS+L+SSVDAKLQAICQRLSQE+ Sbjct: 88 NSDNGSPNVLSPPGNALSVLKSSVDAKLQAICQRLSQEN 126