BLASTX nr result
ID: Ephedra28_contig00001063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00001063 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD27392.1| dehydroascorbate reductase [Zinnia elegans] 56 6e-06 gb|ABG49123.1| dehydroascorbate reductase [Malus domestica] 55 7e-06 >dbj|BAD27392.1| dehydroascorbate reductase [Zinnia elegans] Length = 214 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 1 SVPSDLACVNKYMEAFFSRPSFLATKPAGEEYVIAGWAAKVN 126 +VP L V+ YM++ FSR SF TKPA EEYV+AGWA KVN Sbjct: 171 TVPESLTHVHDYMKSLFSRESFEKTKPAKEEYVVAGWAPKVN 212 >gb|ABG49123.1| dehydroascorbate reductase [Malus domestica] Length = 213 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +1 Query: 1 SVPSDLACVNKYMEAFFSRPSFLATKPAGEEYVIAGWAAKVN 126 +VP+DLA +KY E FSR SF+ T PA E+YVIAGW KVN Sbjct: 171 TVPADLAHYHKYTELLFSRESFVKTAPADEKYVIAGWEPKVN 212