BLASTX nr result
ID: Ephedra28_contig00000283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00000283 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003579548.1| PREDICTED: transportin-1 [Brachypodium dista... 56 6e-06 gb|EOY15130.1| Transportin 1 isoform 1 [Theobroma cacao] 55 1e-05 >ref|XP_003579548.1| PREDICTED: transportin-1 [Brachypodium distachyon] Length = 894 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -3 Query: 387 SEICQVLQGFKQVLGEAGWEQLMSAIEPQAKAKLQKYGV 271 +E+CQ+L G+KQ+LG AGWEQ MS +EP +L +YGV Sbjct: 856 NEVCQILNGYKQMLGSAGWEQCMSTLEPAVVQRLARYGV 894 >gb|EOY15130.1| Transportin 1 isoform 1 [Theobroma cacao] Length = 910 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = -3 Query: 387 SEICQVLQGFKQVLGEAGWEQLMSAIEPQAKAKLQKYG 274 +E+CQ+L G+KQ+L + GWEQ +S +EPQ K KL YG Sbjct: 851 NEVCQILLGYKQILKDGGWEQCLSTLEPQVKEKLSNYG 888