BLASTX nr result
ID: Ephedra28_contig00000031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00000031 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein C... 71 2e-10 ref|NP_001105698.1| light harvesting chlorophyll a/b binding pro... 70 4e-10 ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 prec... 70 4e-10 tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea m... 70 4e-10 ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [S... 70 4e-10 gb|ACN36418.1| unknown [Zea mays] 70 4e-10 gb|ACF82848.1| unknown [Zea mays] 70 4e-10 gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-P... 69 5e-10 gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indi... 69 5e-10 ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein C... 69 6e-10 ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein C... 69 8e-10 gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - ... 68 1e-09 ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] g... 68 1e-09 gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - ... 68 1e-09 gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza... 68 1e-09 emb|CAA44777.1| Precursor of CP29, core chlorophyll a/b binding ... 66 5e-09 gb|ABW90989.1| LHCB5 [Phyllostachys edulis] 65 7e-09 gb|ACX71300.1| chloroplast pigment-binding protein CP26 [Capsicu... 65 9e-09 gb|EMT03206.1| Chlorophyll a-b binding protein CP26, chloroplast... 65 1e-08 gb|EMS49688.1| Chlorophyll a-b binding protein CP26, chloroplast... 65 1e-08 >ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Oryza brachyantha] Length = 283 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/59 (59%), Positives = 41/59 (69%) Frame = -2 Query: 179 KVVCLFGRXXXXXXXXXXXXXKVSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 K+V LFG+ V++SS DI DELAKWYGPDRR FLPEGLLD+SE+PEY Sbjct: 33 KIVSLFGKKPAPKPKPAA----VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPEY 87 >ref|NP_001105698.1| light harvesting chlorophyll a/b binding protein5 precursor [Zea mays] gi|733454|gb|AAA64414.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|414591311|tpg|DAA41882.1| TPA: chlorophyll a/b-binding apoprotein CP26 Precursor [Zea mays] Length = 283 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|733456|gb|AAA64415.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] Length = 283 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea mays] Length = 95 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] gi|241936406|gb|EES09551.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] Length = 282 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 50 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 86 >gb|ACN36418.1| unknown [Zea mays] Length = 186 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >gb|ACF82848.1| unknown [Zea mays] Length = 283 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-PhE9 [Phyllostachys edulis] Length = 283 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 110 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 S+S SDI DELAKWYGPDRR FLPEGLLD+SE+PEY Sbjct: 52 SSSGSDIGDELAKWYGPDRRIFLPEGLLDRSEVPEY 87 >gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indica Group] Length = 283 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+PEY Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPEY 87 >ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Brachypodium distachyon] Length = 286 Score = 68.9 bits (167), Expect = 6e-10 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = -2 Query: 179 KVVCLFGRXXXXXXXXXXXXXKVSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 K+V LFG VS+S +DI DELAKWYGPDRR FLP+GLLD+SE+PEY Sbjct: 33 KIVSLFG-GFNKKPAAKPKPAPVSSSGADIDDELAKWYGPDRRIFLPDGLLDRSEVPEY 90 >ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Setaria italica] Length = 283 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DISDELAKWYGPDRR +LP+GLLD+SE+PEY Sbjct: 51 VTSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEY 87 >gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|77549543|gb|ABA92340.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 225 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+Y Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDY 87 >ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] gi|62733869|gb|AAX95978.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864184|gb|ABA92338.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] gi|113644815|dbj|BAF27956.1| Os11g0242800 [Oryza sativa Japonica Group] gi|125576735|gb|EAZ17957.1| hypothetical protein OsJ_33501 [Oryza sativa Japonica Group] gi|215692422|dbj|BAG87842.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704351|dbj|BAG93785.1| unnamed protein product [Oryza sativa Japonica Group] Length = 283 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+Y Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDY 87 >gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864187|gb|ABA92339.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 245 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+Y Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDY 87 >gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 186 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+Y Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDY 87 >emb|CAA44777.1| Precursor of CP29, core chlorophyll a/b binding (CAB) protein of photosystem II (PSII) [Hordeum vulgare subsp. vulgare] gi|326511355|dbj|BAJ87691.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|445122|prf||1908428A chlorophyll a/b-binding protein Length = 286 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V+TSS+ I DELAKWYGPDRR +LP GLLD+SE+PEY Sbjct: 54 VATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEY 90 >gb|ABW90989.1| LHCB5 [Phyllostachys edulis] Length = 283 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 110 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 S+S SDI DELAKWYGPDRR FL EGLLD+SE+PEY Sbjct: 52 SSSGSDIGDELAKWYGPDRRIFLLEGLLDRSEVPEY 87 >gb|ACX71300.1| chloroplast pigment-binding protein CP26 [Capsicum annuum] Length = 287 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 110 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 + ++S + DELAKWYGPDRR FLPEGLLDKSEIPEY Sbjct: 56 AAAASPLDDELAKWYGPDRRIFLPEGLLDKSEIPEY 91 >gb|EMT03206.1| Chlorophyll a-b binding protein CP26, chloroplastic [Aegilops tauschii] Length = 286 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V+TSS I DELAKWYGPDRR +LP GLLD+SE+PEY Sbjct: 54 VATSSVGIDDELAKWYGPDRRIYLPNGLLDRSEVPEY 90 >gb|EMS49688.1| Chlorophyll a-b binding protein CP26, chloroplastic [Triticum urartu] Length = 359 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 113 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEY 3 V+TSS I DELAKWYGPDRR +LP GLLD+SE+PEY Sbjct: 127 VATSSVGIDDELAKWYGPDRRIYLPNGLLDRSEVPEY 163