BLASTX nr result
ID: Ephedra28_contig00000029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra28_contig00000029 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein C... 86 7e-15 gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-P... 84 2e-14 gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indi... 84 2e-14 ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein C... 84 3e-14 gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - ... 83 4e-14 ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] g... 83 4e-14 gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - ... 83 4e-14 gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza... 83 4e-14 ref|NP_001105698.1| light harvesting chlorophyll a/b binding pro... 82 7e-14 ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 prec... 82 7e-14 tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea m... 82 7e-14 ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [S... 82 7e-14 gb|ACN36418.1| unknown [Zea mays] 82 7e-14 gb|ACF82848.1| unknown [Zea mays] 82 7e-14 ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein C... 81 2e-13 emb|CAA44777.1| Precursor of CP29, core chlorophyll a/b binding ... 80 2e-13 gb|ABW90989.1| LHCB5 [Phyllostachys edulis] 80 3e-13 gb|ACX71300.1| chloroplast pigment-binding protein CP26 [Capsicu... 80 4e-13 gb|EMT03206.1| Chlorophyll a-b binding protein CP26, chloroplast... 79 5e-13 gb|EMS49688.1| Chlorophyll a-b binding protein CP26, chloroplast... 79 5e-13 >ref|XP_006662849.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Oryza brachyantha] Length = 283 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/66 (63%), Positives = 48/66 (72%) Frame = +3 Query: 225 KVVCLFGRXXXXXXXXXXXXXXVSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYL 404 K+V LFG+ V++SS DI DELAKWYGPDRR FLPEGLLD+SE+PEYL Sbjct: 33 KIVSLFGKKPAPKPKPAA----VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPEYL 88 Query: 405 NGEVPG 422 NGEVPG Sbjct: 89 NGEVPG 94 >gb|ABX47017.1| chloroplast chlorophyll a/b binding protein cab-PhE9 [Phyllostachys edulis] Length = 283 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 294 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 S+S SDI DELAKWYGPDRR FLPEGLLD+SE+PEYLNGEVPG Sbjct: 52 SSSGSDIGDELAKWYGPDRRIFLPEGLLDRSEVPEYLNGEVPG 94 >gb|EAY80485.1| hypothetical protein OsI_35663 [Oryza sativa Indica Group] Length = 283 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+PEYLNGEVPG Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPEYLNGEVPG 94 >ref|XP_003577654.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Brachypodium distachyon] Length = 286 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/66 (62%), Positives = 47/66 (71%) Frame = +3 Query: 225 KVVCLFGRXXXXXXXXXXXXXXVSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYL 404 K+V LFG VS+S +DI DELAKWYGPDRR FLP+GLLD+SE+PEYL Sbjct: 33 KIVSLFG-GFNKKPAAKPKPAPVSSSGADIDDELAKWYGPDRRIFLPDGLLDRSEVPEYL 91 Query: 405 NGEVPG 422 NGEVPG Sbjct: 92 NGEVPG 97 >gb|AAX95979.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|77549543|gb|ABA92340.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 225 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+YLNGEVPG Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPG 94 >ref|NP_001067593.1| Os11g0242800 [Oryza sativa Japonica Group] gi|62733869|gb|AAX95978.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864184|gb|ABA92338.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] gi|113644815|dbj|BAF27956.1| Os11g0242800 [Oryza sativa Japonica Group] gi|125576735|gb|EAZ17957.1| hypothetical protein OsJ_33501 [Oryza sativa Japonica Group] gi|215692422|dbj|BAG87842.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704351|dbj|BAG93785.1| unnamed protein product [Oryza sativa Japonica Group] Length = 283 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+YLNGEVPG Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPG 94 >gb|AAX95980.1| chlorophyll a/b-binding protein CP26 precursor - maize [Oryza sativa Japonica Group] gi|108864187|gb|ABA92339.2| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 245 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+YLNGEVPG Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPG 94 >gb|ABG22425.1| Chlorophyll A-B binding protein, expressed [Oryza sativa Japonica Group] Length = 186 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DI DELAKWYGPDRR FLPEGLLD+SE+P+YLNGEVPG Sbjct: 51 VTSSSPDIGDELAKWYGPDRRIFLPEGLLDRSEVPDYLNGEVPG 94 >ref|NP_001105698.1| light harvesting chlorophyll a/b binding protein5 precursor [Zea mays] gi|733454|gb|AAA64414.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|414591311|tpg|DAA41882.1| TPA: chlorophyll a/b-binding apoprotein CP26 Precursor [Zea mays] Length = 283 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >ref|NP_001105374.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] gi|733456|gb|AAA64415.1| chlorophyll a/b-binding apoprotein CP26 precursor [Zea mays] Length = 283 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >tpg|DAA41881.1| TPA: hypothetical protein ZEAMMB73_898154 [Zea mays] Length = 95 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >ref|XP_002450563.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] gi|241936406|gb|EES09551.1| hypothetical protein SORBIDRAFT_05g007070 [Sorghum bicolor] Length = 282 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 50 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 93 >gb|ACN36418.1| unknown [Zea mays] Length = 186 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >gb|ACF82848.1| unknown [Zea mays] Length = 283 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 VS+SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VSSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >ref|XP_004978995.1| PREDICTED: chlorophyll a-b binding protein CP26, chloroplastic-like [Setaria italica] Length = 283 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V++SS DISDELAKWYGPDRR +LP+GLLD+SE+PEYL GEVPG Sbjct: 51 VTSSSPDISDELAKWYGPDRRIYLPDGLLDRSEVPEYLTGEVPG 94 >emb|CAA44777.1| Precursor of CP29, core chlorophyll a/b binding (CAB) protein of photosystem II (PSII) [Hordeum vulgare subsp. vulgare] gi|326511355|dbj|BAJ87691.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|445122|prf||1908428A chlorophyll a/b-binding protein Length = 286 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V+TSS+ I DELAKWYGPDRR +LP GLLD+SE+PEYLNGEVPG Sbjct: 54 VATSSAGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPG 97 >gb|ABW90989.1| LHCB5 [Phyllostachys edulis] Length = 283 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +3 Query: 294 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 S+S SDI DELAKWYGPDRR FL EGLLD+SE+PEYLNGEVPG Sbjct: 52 SSSGSDIGDELAKWYGPDRRIFLLEGLLDRSEVPEYLNGEVPG 94 >gb|ACX71300.1| chloroplast pigment-binding protein CP26 [Capsicum annuum] Length = 287 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 294 STSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 + ++S + DELAKWYGPDRR FLPEGLLDKSEIPEYLNGEVPG Sbjct: 56 AAAASPLDDELAKWYGPDRRIFLPEGLLDKSEIPEYLNGEVPG 98 >gb|EMT03206.1| Chlorophyll a-b binding protein CP26, chloroplastic [Aegilops tauschii] Length = 286 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V+TSS I DELAKWYGPDRR +LP GLLD+SE+PEYLNGEVPG Sbjct: 54 VATSSVGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPG 97 >gb|EMS49688.1| Chlorophyll a-b binding protein CP26, chloroplastic [Triticum urartu] Length = 359 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +3 Query: 291 VSTSSSDISDELAKWYGPDRRTFLPEGLLDKSEIPEYLNGEVPG 422 V+TSS I DELAKWYGPDRR +LP GLLD+SE+PEYLNGEVPG Sbjct: 127 VATSSVGIDDELAKWYGPDRRIYLPNGLLDRSEVPEYLNGEVPG 170