BLASTX nr result
ID: Ephedra27_contig00031448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00031448 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827530.1| hypothetical protein AMTR_s00009p00206310 [A... 55 1e-05 >ref|XP_006827530.1| hypothetical protein AMTR_s00009p00206310 [Amborella trichopoda] gi|548832150|gb|ERM94946.1| hypothetical protein AMTR_s00009p00206310 [Amborella trichopoda] Length = 790 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = +3 Query: 3 NVLLDYDFTVKLSDFGIAKLLGNYDITETSTLKGSIGYTAPDW 131 N+LLD+DFT K+SDFG+AKLLG +T +G+ GY AP+W Sbjct: 609 NILLDHDFTAKVSDFGMAKLLGREFSRVATTTRGTRGYLAPEW 651