BLASTX nr result
ID: Ephedra27_contig00031275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00031275 (502 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD32906.1| putative retroelement pol polyprotein [Arabidopsi... 60 4e-07 dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsi... 58 1e-06 emb|CAN74029.1| hypothetical protein VITISV_013540 [Vitis vinifera] 55 1e-05 >gb|AAD32906.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 822 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = -2 Query: 168 NYWPNKSLD*KYPLQVFTKSTPSINHLRVFGSKCYYHFPDKNRRKLD*KERIRIFI 1 N P ++L K PL+ ++ S PS++H++VFGS CY H PD+ RRK D K + IF+ Sbjct: 360 NRTPTRTLKNKTPLEAWSDSKPSVSHMKVFGSICYVHIPDEKRRKWDDKSKRAIFV 415 >dbj|BAB01972.1| copia-like retrotransposable element [Arabidopsis thaliana] Length = 1499 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/61 (45%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Frame = -2 Query: 180 TNLLNYWPNKSLD*KY-PLQVFTKSTPSINHLRVFGSKCYYHFPDKNRRKLD*KERIRIF 4 T L N P+KSL+ P+++++ PS++HL+VFG CY H PD+ RRKLD K + IF Sbjct: 653 TYLQNRLPSKSLEKGVTPMEIWSGKKPSVDHLKVFGCVCYIHIPDEKRRKLDTKAKQGIF 712 Query: 3 I 1 + Sbjct: 713 V 713 >emb|CAN74029.1| hypothetical protein VITISV_013540 [Vitis vinifera] Length = 894 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/63 (44%), Positives = 36/63 (57%) Frame = -2 Query: 189 NIFTNLLNYWPNKSLD*KYPLQVFTKSTPSINHLRVFGSKCYYHFPDKNRRKLD*KERIR 10 N LLN P KSL K P + + P +NHL++FGS CYYH P+ R KLD + + Sbjct: 224 NTSVYLLNRLPTKSLKNKTPYEEWYGVKPFVNHLKIFGSICYYHVPEPKRSKLDSRAQKG 283 Query: 9 IFI 1 I I Sbjct: 284 ILI 286