BLASTX nr result
ID: Ephedra27_contig00030895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030895 (384 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006302331.1| hypothetical protein CARUB_v10020389mg [Caps... 59 9e-07 ref|XP_002886503.1| pentatricopeptide repeat-containing protein ... 58 2e-06 ref|NP_564786.1| pentatricopeptide repeat-containing protein [Ar... 56 4e-06 gb|AAM62848.1| putative membrane-associated salt-inducible prote... 56 6e-06 >ref|XP_006302331.1| hypothetical protein CARUB_v10020389mg [Capsella rubella] gi|482571041|gb|EOA35229.1| hypothetical protein CARUB_v10020389mg [Capsella rubella] Length = 408 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 3/70 (4%) Frame = +2 Query: 182 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 352 +T N + Q LC KK ++AK LL L + N TY H+IR FC ++++E+A +L ++ Sbjct: 258 STYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDLEEAKKLFKV 317 Query: 353 MINKGIVPSS 382 M+N+G P S Sbjct: 318 MVNRGCKPDS 327 >ref|XP_002886503.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332344|gb|EFH62762.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 408 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = +2 Query: 182 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 352 +T N + Q LC KK ++AK LL L + N TY H+IR FC +++ E+A +L ++ Sbjct: 258 STYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIRGFCNEDDFEEAKKLFKV 317 Query: 353 MINKGIVPSS 382 M+N+G P S Sbjct: 318 MVNRGCKPDS 327 >ref|NP_564786.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806489|sp|Q8LE47.2|PPR87_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g61870, mitochondrial; AltName: Full=Protein PENTATRICOPEPTIDE REPEAT 336; Flags: Precursor gi|16226403|gb|AAL16159.1|AF428391_1 At1g61870/F8K4_8 [Arabidopsis thaliana] gi|3367521|gb|AAC28506.1| Similar to gb|U08285 membrane-associated salt-inducible protein from Nicotiana tabacum. ESTs gb|T44131 and gb|T04378 come from this gene [Arabidopsis thaliana] gi|17065564|gb|AAL32936.1| Unknown protein [Arabidopsis thaliana] gi|32815835|gb|AAP88326.1| At1g61870 [Arabidopsis thaliana] gi|332195777|gb|AEE33898.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 408 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +2 Query: 182 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 352 +T N + Q LC KK ++AK LL L + N TY H+I FC +++ E+A +L ++ Sbjct: 258 STYNIRIQSLCKRKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKI 317 Query: 353 MINKGIVPSS 382 M+N+G P S Sbjct: 318 MVNRGCKPDS 327 >gb|AAM62848.1| putative membrane-associated salt-inducible protein [Arabidopsis thaliana] Length = 407 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +2 Query: 182 TTINPQFQGLCNGKKLQQAKVLL---LRESITTNRATYEHIIRCFCMDNNIEQASELLEL 352 +T N + Q LC KK ++AK LL L + N TY H+I FC +++ E+A +L ++ Sbjct: 257 STYNIRIQSLCKKKKSKEAKALLDGMLSAGMKPNTVTYSHLIHGFCNEDDFEEAKKLFKV 316 Query: 353 MINKGIVPSS 382 M+N+G P S Sbjct: 317 MVNRGCKPDS 326