BLASTX nr result
ID: Ephedra27_contig00030835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030835 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24133.3| unnamed protein product [Vitis vinifera] 49 2e-08 ref|XP_006832890.1| hypothetical protein AMTR_s00095p00111310 [A... 54 6e-06 >emb|CBI24133.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 48.5 bits (114), Expect(2) = 2e-08 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = -1 Query: 91 PDMGILLSGCQSNETSADACPTGNLSEAFG 2 PD GIL+SGCQ+++TSADA P+GN +EA+G Sbjct: 286 PDNGILISGCQTDQTSADASPSGNSAEAYG 315 Score = 35.4 bits (80), Expect(2) = 2e-08 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = -3 Query: 350 EVLKERSGDKTLQLSNINEAVFKVFGDRASPSIKKSASFSVVASPKPKDG--DTKDDSVK 177 E+LK+++G + + + +F VFG+ ASP +KK F V K + G + +D K Sbjct: 207 EILKQKTGKDDIDVGKLRPTLFDVFGEDASPKVKK---FMNVVMNKLQQGGEENNEDYAK 263 Query: 176 SA 171 A Sbjct: 264 PA 265 >ref|XP_006832890.1| hypothetical protein AMTR_s00095p00111310 [Amborella trichopoda] gi|548837390|gb|ERM98168.1| hypothetical protein AMTR_s00095p00111310 [Amborella trichopoda] Length = 313 Score = 53.9 bits (128), Expect(2) = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 91 PDMGILLSGCQSNETSADACPTGNLSEAFG 2 PD+GILLSGCQSNETSADA P G++S+AFG Sbjct: 226 PDVGILLSGCQSNETSADAFPDGDISKAFG 255 Score = 21.6 bits (44), Expect(2) = 6e-06 Identities = 12/49 (24%), Positives = 20/49 (40%) Frame = -3 Query: 347 VLKERSGDKTLQLSNINEAVFKVFGDRASPSIKKSASFSVVASPKPKDG 201 +L + L I + ++FGD+A + SFS + P G Sbjct: 181 ILNHLAAASGLNSQEITYHLHQLFGDKAFFRFESKESFSALKPASPDVG 229