BLASTX nr result
ID: Ephedra27_contig00030664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030664 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829844.1| hypothetical protein AMTR_s00119p00113390 [A... 45 1e-05 >ref|XP_006829844.1| hypothetical protein AMTR_s00119p00113390 [Amborella trichopoda] gi|548835425|gb|ERM97260.1| hypothetical protein AMTR_s00119p00113390 [Amborella trichopoda] Length = 894 Score = 45.1 bits (105), Expect(2) = 1e-05 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 43 TNSSDA*TLVHVMSFERRERGWNNLTIIPENECKIQFKE 159 T DA T+V V + ERRERGW ++ ++P +ECK FKE Sbjct: 48 TGPRDAHTMVRVKNVERRERGWYDVIVLPLHECKWTFKE 86 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 153 QRGDMVVLSMSK*GEGRLK--KFVSGNGSDETKGKNSSRLGGRVWKY*P 293 + GD+ VLS SK RL+ K SG DE + + + R+ G V ++ P Sbjct: 85 KEGDVAVLSSSKPETVRLRRTKVNSGTNEDEVESEAAGRVAGTVRRFSP 133