BLASTX nr result
ID: Ephedra27_contig00030601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030601 (421 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004295891.1| PREDICTED: putative pentatricopeptide repeat... 83 3e-14 ref|XP_002310039.2| hypothetical protein POPTR_0007s06780g [Popu... 82 6e-14 gb|EMJ24201.1| hypothetical protein PRUPE_ppa006785mg [Prunus pe... 81 2e-13 ref|XP_006340302.1| PREDICTED: putative pentatricopeptide repeat... 80 4e-13 ref|XP_004251431.1| PREDICTED: putative pentatricopeptide repeat... 80 4e-13 gb|ESW04122.1| hypothetical protein PHAVU_011G069000g [Phaseolus... 79 5e-13 ref|XP_003591356.1| Pentatricopeptide repeat-containing protein ... 79 6e-13 ref|XP_004163923.1| PREDICTED: putative pentatricopeptide repeat... 79 8e-13 ref|XP_004150840.1| PREDICTED: putative pentatricopeptide repeat... 79 8e-13 ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat... 79 8e-13 ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat... 78 1e-12 gb|EOX95372.1| Pentatricopeptide repeat superfamily protein isof... 77 2e-12 gb|EOX95371.1| Pentatricopeptide repeat superfamily protein isof... 77 2e-12 gb|EPS57811.1| hypothetical protein M569_17007, partial [Genlise... 77 2e-12 ref|XP_004495883.1| PREDICTED: putative pentatricopeptide repeat... 77 3e-12 ref|XP_002515231.1| pentatricopeptide repeat-containing protein,... 76 5e-12 ref|XP_006841601.1| hypothetical protein AMTR_s00003p00209480 [A... 75 7e-12 ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat... 75 7e-12 gb|EXB55995.1| hypothetical protein L484_018781 [Morus notabilis] 75 9e-12 ref|XP_006418341.1| hypothetical protein EUTSA_v10007463mg [Eutr... 74 2e-11 >ref|XP_004295891.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Fragaria vesca subsp. vesca] Length = 504 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/74 (48%), Positives = 54/74 (72%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++MI+ GFG Y V D+L LCD GKL +AE+CFL ++KGH P+ S+ R+KVL+EL Sbjct: 405 WNDMIERGFGSYILVSDVLFDLLCDMGKLTEAETCFLQMVEKGHKPSNVSFRRIKVLMEL 464 Query: 240 TQQHERIKLISERL 199 +HE +K ++E++ Sbjct: 465 ANKHEALKNLTEKM 478 >ref|XP_002310039.2| hypothetical protein POPTR_0007s06780g [Populus trichocarpa] gi|550334290|gb|EEE90489.2| hypothetical protein POPTR_0007s06780g [Populus trichocarpa] Length = 509 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/74 (47%), Positives = 54/74 (72%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L+ LCD GKL +AE CFL ++KGH P+ S+ R+KVL+EL Sbjct: 411 WNDMVEKGFGSYILVSDVLLGMLCDMGKLVEAEKCFLQMVEKGHKPSNVSFRRIKVLMEL 470 Query: 240 TQQHERIKLISERL 199 +H+ I+ +SE++ Sbjct: 471 ANKHDAIRNLSEKM 484 >gb|EMJ24201.1| hypothetical protein PRUPE_ppa006785mg [Prunus persica] Length = 395 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/74 (47%), Positives = 53/74 (71%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL +AE CFL ++KGH P+ S+ R+KVL+EL Sbjct: 295 WNDMVEKGFGSYILVSDVLFDLLCDLGKLMEAERCFLQMMEKGHKPSNVSFRRIKVLMEL 354 Query: 240 TQQHERIKLISERL 199 +HE +K ++E++ Sbjct: 355 ANKHEALKNLTEKM 368 >ref|XP_006340302.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Solanum tuberosum] Length = 505 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/74 (48%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 WD+M++ GFG Y V D+L LCD GKL +AE CFL ++KG P+ S+ R+KVL+EL Sbjct: 406 WDDMMERGFGSYILVSDVLFDLLCDLGKLAEAERCFLQMVNKGQKPSNVSFRRIKVLMEL 465 Query: 240 TQQHERIKLISERL 199 + E +KL+SE++ Sbjct: 466 ANKQETLKLLSEKM 479 >ref|XP_004251431.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Solanum lycopersicum] Length = 500 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/74 (48%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 WD+M++ GFG Y V D+L LCD GKL +AE CFL ++KG P+ S+ R+KVL+EL Sbjct: 406 WDDMMERGFGSYILVSDVLFDLLCDLGKLAEAERCFLQMVNKGQKPSNVSFRRIKVLMEL 465 Query: 240 TQQHERIKLISERL 199 + E +KL+SE++ Sbjct: 466 ANKQEALKLLSEKM 479 >gb|ESW04122.1| hypothetical protein PHAVU_011G069000g [Phaseolus vulgaris] Length = 500 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/74 (43%), Positives = 53/74 (71%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W+ M++ GFG Y V D+L LCD GKL++AE CFL+ ++KG P+ S+ R+KVL+EL Sbjct: 400 WENMVEKGFGSYTLVSDVLFDLLCDMGKLEEAEKCFLEMIEKGQKPSNVSFRRIKVLMEL 459 Query: 240 TQQHERIKLISERL 199 +HE ++ +++++ Sbjct: 460 ANRHEALESLTQKM 473 >ref|XP_003591356.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355480404|gb|AES61607.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 518 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/74 (45%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W EM++ GFG Y V D+L LCD GKL +AE CFL+ ++KG P+ S+ R+KVL+EL Sbjct: 394 WGEMVEKGFGSYTLVSDVLFDMLCDMGKLMEAEKCFLEMIEKGQRPSNVSFKRIKVLMEL 453 Query: 240 TQQHERIKLISERL 199 +HE I+ +++++ Sbjct: 454 ANKHEAIQNLTQKM 467 >ref|XP_004163923.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Cucumis sativus] Length = 495 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/74 (48%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++MI GFG Y V + L LCD GKL +AESCFL +DKGH P+ S+ R+KVL+EL Sbjct: 408 WNDMIQKGFGSYILVSEELFDLLCDLGKLIEAESCFLQMVDKGHKPSYTSFKRIKVLMEL 467 Query: 240 TQQHERIKLISERL 199 +HE ++ +S+++ Sbjct: 468 ANKHEALQNLSKKM 481 >ref|XP_004150840.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Cucumis sativus] Length = 495 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/74 (48%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++MI GFG Y V + L LCD GKL +AESCFL +DKGH P+ S+ R+KVL+EL Sbjct: 408 WNDMIQKGFGSYILVSEELFDLLCDLGKLIEAESCFLQMVDKGHKPSYTSFKRIKVLMEL 467 Query: 240 TQQHERIKLISERL 199 +HE ++ +S+++ Sbjct: 468 ANKHEALQNLSKKM 481 >ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 279 Score = 78.6 bits (192), Expect = 8e-13 Identities = 32/74 (43%), Positives = 53/74 (71%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W +M++ GFG Y V D+L LCD GKL++AE CFL+ ++KG P+ S+ R+KVL+EL Sbjct: 196 WGDMVEKGFGSYTLVSDVLFDLLCDMGKLEEAEKCFLEMVEKGQKPSHVSFRRIKVLMEL 255 Query: 240 TQQHERIKLISERL 199 +HE ++ +++++ Sbjct: 256 ANRHEALQSLTQKM 269 >ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 500 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/74 (43%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W +M++ GFG Y V D+L LCD GKL++AE CFL+ ++KG P+ S+ R+KVL+EL Sbjct: 400 WGDMVEKGFGSYTLVSDVLFDLLCDMGKLEEAEKCFLEMVEKGQKPSHVSFRRIKVLMEL 459 Query: 240 TQQHERIKLISERL 199 +HE ++ + +++ Sbjct: 460 ANRHEALQSLMQKM 473 >gb|EOX95372.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] Length = 279 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/74 (44%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL +AE CF + ++K H P+ S+ R+KVL+EL Sbjct: 173 WNDMVEKGFGSYVLVSDVLFDLLCDMGKLVEAEKCFSEMIEKRHKPSNVSFRRIKVLMEL 232 Query: 240 TQQHERIKLISERL 199 +HE +K + E++ Sbjct: 233 ANKHEAVKNLKEKM 246 >gb|EOX95371.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 511 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/74 (44%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL +AE CF + ++K H P+ S+ R+KVL+EL Sbjct: 405 WNDMVEKGFGSYVLVSDVLFDLLCDMGKLVEAEKCFSEMIEKRHKPSNVSFRRIKVLMEL 464 Query: 240 TQQHERIKLISERL 199 +HE +K + E++ Sbjct: 465 ANKHEAVKNLKEKM 478 >gb|EPS57811.1| hypothetical protein M569_17007, partial [Genlisea aurea] Length = 449 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/74 (45%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+LI LCD G +DDAE CFL +DKG P+ S+ R+KVL+EL Sbjct: 373 WEDMVELGFGSYTLVSDVLIGLLCDLGMVDDAERCFLQMVDKGQRPSRVSFRRIKVLMEL 432 Query: 240 TQQHERIKLISERL 199 + + E + + E++ Sbjct: 433 SGRFEALSNLREKM 446 >ref|XP_004495883.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Cicer arietinum] Length = 502 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/74 (44%), Positives = 52/74 (70%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W +M++ GFG Y V D+L LCD GKL +AE CFL+ ++KG P+ S+ R+KVL+EL Sbjct: 400 WGDMVEKGFGSYTLVSDVLFDLLCDMGKLLEAEKCFLEMVEKGQKPSNVSFRRIKVLMEL 459 Query: 240 TQQHERIKLISERL 199 +HE I+ +++++ Sbjct: 460 ANRHEAIQNLTQKM 473 >ref|XP_002515231.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545711|gb|EEF47215.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 505 Score = 75.9 bits (185), Expect = 5e-12 Identities = 32/74 (43%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL +AE CFL ++KGH P+ S+ R+KVL+EL Sbjct: 405 WNDMVEKGFGSYILVSDVLFDLLCDMGKLVEAEKCFLQMIEKGHKPSNVSFRRIKVLMEL 464 Query: 240 TQQHERIKLISERL 199 +H+ + + +++ Sbjct: 465 VNKHDALLNLQKKM 478 >ref|XP_006841601.1| hypothetical protein AMTR_s00003p00209480 [Amborella trichopoda] gi|548843622|gb|ERN03276.1| hypothetical protein AMTR_s00003p00209480 [Amborella trichopoda] Length = 436 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/75 (44%), Positives = 50/75 (66%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V DIL LCD GKL + E CFL +DKG P+ ++ R+KVL+EL Sbjct: 352 WNDMVERGFGSYTLVSDILFDMLCDLGKLIEVEKCFLQMIDKGQKPSNAAFKRIKVLMEL 411 Query: 240 TQQHERIKLISERLK 196 + E I +S++++ Sbjct: 412 ANRQEAITYLSKKME 426 >ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Vitis vinifera] Length = 526 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/74 (43%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL + E C L ++KGH P+ S+ R+KVL+EL Sbjct: 426 WNDMVEKGFGSYILVSDVLFDMLCDMGKLVEVEKCCLQMIEKGHKPSNVSFRRIKVLMEL 485 Query: 240 TQQHERIKLISERL 199 +HE ++ ++E++ Sbjct: 486 ANKHEALQNLTEKM 499 >gb|EXB55995.1| hypothetical protein L484_018781 [Morus notabilis] Length = 486 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/74 (43%), Positives = 51/74 (68%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M++ GFG Y V D+L LCD GKL +AE CFL ++KG P+ S+ R+KVL+EL Sbjct: 404 WNDMVEKGFGSYVLVSDVLFDLLCDAGKLMEAERCFLQMVEKGQKPSNVSYRRIKVLMEL 463 Query: 240 TQQHERIKLISERL 199 + + + ++SE++ Sbjct: 464 ANKQDSLHILSEKM 477 >ref|XP_006418341.1| hypothetical protein EUTSA_v10007463mg [Eutrema salsugineum] gi|557096112|gb|ESQ36694.1| hypothetical protein EUTSA_v10007463mg [Eutrema salsugineum] Length = 494 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/74 (40%), Positives = 50/74 (67%) Frame = -2 Query: 420 WDEMIDHGFGCYPRVLDILIAALCDNGKLDDAESCFLDCLDKGHLPNAESWDRLKVLLEL 241 W++M+ GFG Y V D+L+ LCD K+D+AE C L ++KGH P+ S+ R+K+L+EL Sbjct: 412 WEDMVVKGFGSYSLVSDVLLDLLCDLAKVDEAEKCLLQMVEKGHRPSNVSFKRIKLLMEL 471 Query: 240 TQQHERIKLISERL 199 +HE + + +++ Sbjct: 472 ANKHEELDNLKQKM 485