BLASTX nr result
ID: Ephedra27_contig00030546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030546 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ04813.1| hypothetical protein PRUPE_ppa002292mg [Prunus pe... 59 9e-07 >gb|EMJ04813.1| hypothetical protein PRUPE_ppa002292mg [Prunus persica] Length = 691 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/63 (50%), Positives = 43/63 (68%) Frame = +1 Query: 250 GKFIKQIRILCKEGSLEKAIQILHLQDSCSNPSSYKTILNLCLKRNALPQGKIVHAHMIM 429 GKF + I ILC++ L +AIQ+L+ D S S Y T+L LCL++ AL QGK+VHAH + Sbjct: 55 GKFKEAIDILCEQKHLAEAIQLLNRIDRPS-ASIYSTLLQLCLQQRALVQGKLVHAHTKV 113 Query: 430 RGF 438 GF Sbjct: 114 SGF 116