BLASTX nr result
ID: Ephedra27_contig00030467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00030467 (528 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001766380.1| predicted protein [Physcomitrella patens] gi... 58 1e-06 ref|XP_006851710.1| hypothetical protein AMTR_s00040p00209530 [A... 55 7e-06 >ref|XP_001766380.1| predicted protein [Physcomitrella patens] gi|162682289|gb|EDQ68708.1| predicted protein [Physcomitrella patens] Length = 268 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +3 Query: 432 SVPQPMEGLQGSAVPPFLNKTYDMVEDPSTDP 527 S PQPM+GLQ +A PPFL KTYDMV+DP+TDP Sbjct: 43 SAPQPMDGLQSTAPPPFLTKTYDMVDDPATDP 74 >ref|XP_006851710.1| hypothetical protein AMTR_s00040p00209530 [Amborella trichopoda] gi|548855290|gb|ERN13177.1| hypothetical protein AMTR_s00040p00209530 [Amborella trichopoda] Length = 483 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/39 (56%), Positives = 29/39 (74%) Frame = +3 Query: 411 DFEMAEESVPQPMEGLQGSAVPPFLNKTYDMVEDPSTDP 527 DF+ ++PQP+E LQG +PPFL KTYD+V+DP DP Sbjct: 32 DFQEGVPAIPQPLESLQGVPIPPFLTKTYDLVDDPLLDP 70