BLASTX nr result
ID: Ephedra27_contig00029653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00029653 (625 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_689386.1| cytochrome c oxidase subunit 1 [Chaetosphaeridi... 75 1e-11 gb|AEA29869.1| cytochrome c oxidase subunit 1 (mitochondrion) [S... 75 1e-11 gb|AEA11197.1| cytochrome oxidase subunit 1, partial (mitochondr... 75 1e-11 ref|NP_054454.1| cytochrome c oxidase subunit 1 [Marchantia poly... 75 2e-11 ref|NP_943703.1| cytochrome c oxidase subunit 1 [Chara vulgaris]... 75 2e-11 gb|AAC09453.1| coxI intron4 ORF [Marchantia polymorpha] 75 2e-11 gb|AAC09452.1| coxI intron8 ORF [Marchantia polymorpha] 75 2e-11 ref|YP_006073039.1| cox1 gene product (mitochondrion) [Nitella h... 75 2e-11 ref|YP_004927603.1| cytochrome c oxidase subunit 1 (mitochondrio... 75 2e-11 gb|AEB40011.1| cytochrome c oxidase subunit 1 [Funaria hygrometr... 75 2e-11 ref|YP_003276009.1| cytochrome c oxidase subunit 1 (mitochondrio... 75 2e-11 ref|YP_539000.2| cytochrome c oxidase subunit 1 [Physcomitrella ... 75 2e-11 gb|AAZ29195.1| cytochrome c oxidase subunit I [Pellia epiphylla] 75 2e-11 ref|YP_008816172.1| cytochrome c oxidase subunit 1 (mitochondrio... 74 3e-11 ref|YP_008816006.1| cytochrome c oxidase subunit 1 (mitochondrio... 74 3e-11 gb|ABN50271.1| cytochrome oxidase subunit I [Larix gmelinii var.... 74 3e-11 ref|YP_008816096.1| cytochrome c oxidase subunit 1 (mitochondrio... 74 3e-11 dbj|BAJ21558.1| cytochrome c oxidase subunit 1 [Pterosperma cris... 74 3e-11 gb|ABN50288.1| cytochrome oxidase subunit I [Ephedra triandra] 74 4e-11 emb|CBJ20678.1| hypothetical protein [Beta vulgaris subsp. marit... 73 6e-11 >ref|NP_689386.1| cytochrome c oxidase subunit 1 [Chaetosphaeridium globosum] gi|22417002|gb|AAM96601.1|AF494279_6 cytochrome c oxidase subunit 1 [Chaetosphaeridium globosum] Length = 526 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 IGTCFSILIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPALI 79 >gb|AEA29869.1| cytochrome c oxidase subunit 1 (mitochondrion) [Selaginella moellendorffii] Length = 536 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTCLS + ELAQ GNQLLG +HQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 LGTCLSVLIRMELAQPGNQLLGGHHQLYNVLITAHAFLMIFFMVMPAMI 79 >gb|AEA11197.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Selaginella moellendorffii] Length = 450 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTCLS + ELAQ GNQLLG +HQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 LGTCLSVLIRMELAQPGNQLLGGHHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|NP_054454.1| cytochrome c oxidase subunit 1 [Marchantia polymorpha] gi|461785|sp|P26856.2|COX1_MARPO RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|786237|gb|AAC09451.1| coxI [Marchantia polymorpha] Length = 522 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|NP_943703.1| cytochrome c oxidase subunit 1 [Chara vulgaris] gi|32966590|gb|AAP92173.1| cytochrome c oxidase subunit 1 [Chara vulgaris] Length = 524 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPALI 79 >gb|AAC09453.1| coxI intron4 ORF [Marchantia polymorpha] Length = 434 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >gb|AAC09452.1| coxI intron8 ORF [Marchantia polymorpha] Length = 636 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|YP_006073039.1| cox1 gene product (mitochondrion) [Nitella hyalina] gi|335354166|gb|AEH42853.1| cytochrome c oxidase subunit 1 (mitochondrion) [Nitella hyalina] Length = 522 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPALI 79 >ref|YP_004927603.1| cytochrome c oxidase subunit 1 (mitochondrion) [Anomodon rugelii] gi|529249679|ref|YP_008378673.1| cytochrome c oxidase subunit 1 (mitochondrion) [Anomodon attenuatus] gi|336089460|gb|AEH99650.1| cytochrome c oxidase subunit 1 [Anomodon rugelii] gi|402746412|gb|AFQ93997.1| cytochrome c oxidase subunit 1 (mitochondrion) [Anomodon attenuatus] Length = 522 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >gb|AEB40011.1| cytochrome c oxidase subunit 1 [Funaria hygrometrica] gi|328905406|gb|AEB54951.1| cytochrome oxidase subunit 1 [Funaria hygrometrica] Length = 523 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|YP_003276009.1| cytochrome c oxidase subunit 1 (mitochondrion) [Pleurozia purpurea] gi|237780747|gb|ACR19393.1| cytochrome c oxidase subunit 1 [Pleurozia purpurea] Length = 522 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|YP_539000.2| cytochrome c oxidase subunit 1 [Physcomitrella patens] gi|186942713|dbj|BAE93071.2| cytochrome c oxidase subunit 1 (mitochondrion) [Physcomitrella patens] Length = 522 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >gb|AAZ29195.1| cytochrome c oxidase subunit I [Pellia epiphylla] Length = 523 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSVLIRMELAQPGNQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 79 >ref|YP_008816172.1| cytochrome c oxidase subunit 1 (mitochondrion) [Roya obtusa] gi|557160954|gb|AGZ90368.1| cytochrome c oxidase subunit 1 (mitochondrion) [Roya obtusa] Length = 523 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC+S + ELAQ GNQ+LG NHQLYN+LITAHAF+MI FMV+PA+I Sbjct: 31 MGTCMSILIRMELAQPGNQILGGNHQLYNVLITAHAFVMIFFMVMPALI 79 >ref|YP_008816006.1| cytochrome c oxidase subunit 1 (mitochondrion) [Closterium baillyanum] gi|557160681|gb|AGZ90272.1| cytochrome c oxidase subunit 1 (mitochondrion) [Closterium baillyanum] Length = 522 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC+S + ELAQ GNQ+LG NHQLYN+LITAH FLMI FMV+PA+I Sbjct: 31 MGTCMSVLIRMELAQPGNQILGGNHQLYNVLITAHGFLMIFFMVMPALI 79 >gb|ABN50271.1| cytochrome oxidase subunit I [Larix gmelinii var. principis-rupprechtii] Length = 485 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ G+Q+LG NHQLYN+LITAHAFLMI FMV+PAVI Sbjct: 3 MGTCFSVLIRMELAQPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAVI 51 >ref|YP_008816096.1| cytochrome c oxidase subunit 1 (mitochondrion) [Microspora stagnorum] gi|557160857|gb|AGZ90321.1| cytochrome c oxidase subunit 1 (mitochondrion) [Microspora stagnorum] Length = 535 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN++ITAHAFLMI FMV+PA+I Sbjct: 31 MGTCFSMLIRMELAQPGNQILGGNHQLYNVIITAHAFLMIFFMVMPAMI 79 >dbj|BAJ21558.1| cytochrome c oxidase subunit 1 [Pterosperma cristatum] Length = 426 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ GNQ+LG NHQLYN++ITAHAFLMI FMV+PA+I Sbjct: 14 LGTCFSMLIRMELAQPGNQILGGNHQLYNVIITAHAFLMIFFMVMPALI 62 >gb|ABN50288.1| cytochrome oxidase subunit I [Ephedra triandra] Length = 486 Score = 73.6 bits (179), Expect = 4e-11 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S L ELAQ G+QLLG NHQLYN+LITAH FLMI FMV+PAVI Sbjct: 3 MGTCFSVPLCIELAQPGDQLLGGNHQLYNVLITAHTFLMIFFMVMPAVI 51 >emb|CBJ20678.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 864 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 13 VGTCLSANLHTELAQHGNQLLGRNHQLYNLLITAHAFLMIIFMVIPAVI 159 +GTC S + ELAQ G+Q+LG NHQLYN+LITAHAFLMI FMV+PA+I Sbjct: 370 MGTCFSVLIRMELAQPGDQILGGNHQLYNVLITAHAFLMIFFMVMPAMI 418