BLASTX nr result
ID: Ephedra27_contig00029181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00029181 (514 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001753885.1| predicted protein [Physcomitrella patens] gi... 56 4e-06 ref|XP_001786095.1| predicted protein [Physcomitrella patens] gi... 56 4e-06 >ref|XP_001753885.1| predicted protein [Physcomitrella patens] gi|162694861|gb|EDQ81207.1| predicted protein [Physcomitrella patens] Length = 1847 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = +2 Query: 365 NTTNRKKYPAVFCQTKKKNCSHYALGGYQFCMLHILEDSLAPYKQCDF 508 N ++ K C + +++CS Y L GY+ C+ HILED APYKQCDF Sbjct: 617 NGSSTKARSEHMCHSSRQSCSQYCLQGYKLCLWHILEDPSAPYKQCDF 664 >ref|XP_001786095.1| predicted protein [Physcomitrella patens] gi|162662146|gb|EDQ49094.1| predicted protein [Physcomitrella patens] Length = 1169 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/48 (47%), Positives = 31/48 (64%) Frame = +2 Query: 365 NTTNRKKYPAVFCQTKKKNCSHYALGGYQFCMLHILEDSLAPYKQCDF 508 N ++ K C + +++CS Y L GY+ C+ HILED APYKQCDF Sbjct: 914 NGSSTKARSEHMCHSSRQSCSQYCLQGYKLCLWHILEDPSAPYKQCDF 961