BLASTX nr result
ID: Ephedra27_contig00028781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00028781 (584 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836353.1| hypothetical protein AMTR_s00092p00107280 [A... 61 2e-07 >ref|XP_006836353.1| hypothetical protein AMTR_s00092p00107280 [Amborella trichopoda] gi|548838871|gb|ERM99206.1| hypothetical protein AMTR_s00092p00107280 [Amborella trichopoda] Length = 238 Score = 60.8 bits (146), Expect = 2e-07 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 2/143 (1%) Frame = +2 Query: 62 HVPSIEALRQVFGSYGPAMSPCKFSVYCLETRSSPSESGKFIGNLREGLYVSTGLYITRC 241 ++P ++AL + + F V C + KF G VS + T Sbjct: 77 NIPLVQALLRSASHQATILDTGLFQV-CFGESKDGIPASKF----SSGDTVSIHMLFTGL 131 Query: 242 EDQERLAYGFLALSKSYLREMKGLEWFACMKSLDGDKVVCLFVWEDLKSAYQSF--VDTP 415 ++ L YG +AL+KSY ++G+ +C+ SLD KV+CL VW+ L Y +D Sbjct: 132 DNLYNLTYGCMALAKSYFSNVEGVSSASCLSSLDNPKVLCLHVWKSLDMCYSWLLGLDGG 191 Query: 416 SSCKLFLEDLVLSRKMDLFKVAH 484 ++ + + LV K D+FKV + Sbjct: 192 TTMRPLISHLVKDIKYDVFKVVY 214