BLASTX nr result
ID: Ephedra27_contig00028600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00028600 (496 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513114.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002513114.1| conserved hypothetical protein [Ricinus communis] gi|223548125|gb|EEF49617.1| conserved hypothetical protein [Ricinus communis] Length = 605 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -2 Query: 495 DGQWLHFDDSSVSVVGMKKVLHDQAYLLFYIQI 397 +G WLHFDD+SV+ +G KVLHDQAY+LFY Q+ Sbjct: 573 NGHWLHFDDASVTAIGTSKVLHDQAYVLFYRQV 605