BLASTX nr result
ID: Ephedra27_contig00028484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00028484 (491 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW09460.1| hypothetical protein PHAVU_009G129200g [Phaseolus... 81 1e-13 ref|XP_004502524.1| PREDICTED: pentatricopeptide repeat-containi... 79 8e-13 gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thal... 78 1e-12 ref|NP_177860.2| pentatricopeptide repeat-containing protein [Ar... 78 1e-12 gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily p... 76 4e-12 ref|XP_002889139.1| pentatricopeptide repeat-containing protein ... 76 5e-12 ref|XP_006301167.1| hypothetical protein CARUB_v10021564mg, part... 75 7e-12 ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 gb|ABK26722.1| unknown [Picea sitchensis] 72 6e-11 ref|XP_006390097.1| hypothetical protein EUTSA_v10018469mg [Eutr... 72 1e-10 ref|XP_004161997.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 72 1e-10 ref|XP_004150483.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_002307458.2| pentatricopeptide repeat-containing family p... 69 5e-10 ref|XP_002280443.1| PREDICTED: pentatricopeptide repeat-containi... 69 8e-10 ref|XP_006390810.1| hypothetical protein EUTSA_v10018364mg [Eutr... 67 2e-09 gb|EOY00910.1| Pentatricopeptide repeat-containing protein, puta... 67 2e-09 ref|XP_006472835.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_006434266.1| hypothetical protein CICLE_v10000990mg [Citr... 67 2e-09 ref|XP_002315895.2| hypothetical protein POPTR_0010s12490g [Popu... 67 2e-09 >gb|ESW09460.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] gi|561010554|gb|ESW09461.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] Length = 480 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/145 (26%), Positives = 77/145 (53%) Frame = +2 Query: 56 RHQEIEQWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVE 235 R + + +W L+A+ ++ + + S ++ K+++T ++ AL + ++ VE Sbjct: 8 RKKILSEWVLFAKMHSTSEAIQEVGEASERVSKVMMTCPTLGLDTALNQTGVRVSPDLVE 67 Query: 236 DALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNL 415 + L+ N G+ + F W + Y ++ AY+L+I+ LAK+ Q+ IVW LV+ M Sbjct: 68 NVLKRFENAGMSAFRFFEWSEKQRGYS-HSIRAYHLMIESLAKIRQYQIVWDLVNAMRKK 126 Query: 416 GFITKQTLNIITHGYVMHDKVDQAL 490 G + +T I+ Y +KVD+A+ Sbjct: 127 GMLNVETFCIMMRKYARANKVDEAV 151 >ref|XP_004502524.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Cicer arietinum] gi|502135996|ref|XP_004502525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Cicer arietinum] gi|502135999|ref|XP_004502526.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Cicer arietinum] Length = 480 Score = 78.6 bits (192), Expect = 8e-13 Identities = 40/135 (29%), Positives = 73/135 (54%) Frame = +2 Query: 86 WARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCG 265 +A+ + P+ D A + L K++++ A T++ AL + ++ VE L+ N G Sbjct: 18 FAKTLSTSEPIHDIADVTETLYKVMMSNPAVTLDTALNQTGVRVSPELVEIVLKRFENAG 77 Query: 266 LLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNI 445 + + F W + +Y ++ +AY+L+I+ LAK+ Q+ I+W LV+ M G + +T I Sbjct: 78 MSAFRFFEWAEKQRNYS-HSVKAYHLMIESLAKIRQYQIMWDLVNSMRKKGMVNVETFCI 136 Query: 446 ITHGYVMHDKVDQAL 490 I Y KVD+A+ Sbjct: 137 IMRKYARAHKVDEAV 151 >gb|AAG29201.1|AC078898_11 hypothetical protein [Arabidopsis thaliana] Length = 481 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/136 (28%), Positives = 72/136 (52%) Frame = +2 Query: 83 LWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNC 262 L AR Y+ + D A ++ + K+L++ ++ AL + +++ VED L N Sbjct: 18 LSARLYSSSEQVRDVADVAKNISKVLMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNA 77 Query: 263 GLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLN 442 GLL Y F W + HY+ ++ AY+++I+ AK+ Q+ ++W L++ M + +T Sbjct: 78 GLLTYRFFQWSEKQRHYE-HSVRAYHMMIESTAKIRQYKLMWDLINAMRKKKMLNVETFC 136 Query: 443 IITHGYVMHDKVDQAL 490 I+ Y KVD+A+ Sbjct: 137 IVMRKYARAQKVDEAI 152 >ref|NP_177860.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806398|sp|Q9FVX2.2|PP129_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g77360, mitochondrial; Flags: Precursor gi|332197848|gb|AEE35969.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 517 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/136 (28%), Positives = 72/136 (52%) Frame = +2 Query: 83 LWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNC 262 L AR Y+ + D A ++ + K+L++ ++ AL + +++ VED L N Sbjct: 54 LSARLYSSSEQVRDVADVAKNISKVLMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNA 113 Query: 263 GLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLN 442 GLL Y F W + HY+ ++ AY+++I+ AK+ Q+ ++W L++ M + +T Sbjct: 114 GLLTYRFFQWSEKQRHYE-HSVRAYHMMIESTAKIRQYKLMWDLINAMRKKKMLNVETFC 172 Query: 443 IITHGYVMHDKVDQAL 490 I+ Y KVD+A+ Sbjct: 173 IVMRKYARAQKVDEAI 188 >gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724502|gb|EOY16399.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724503|gb|EOY16400.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724504|gb|EOY16401.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724505|gb|EOY16402.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 480 Score = 76.3 bits (186), Expect = 4e-12 Identities = 40/138 (28%), Positives = 70/138 (50%) Frame = +2 Query: 77 WTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVP 256 W + R P D TS+K+ K++++ + AL + + VED L+ Sbjct: 15 WIVLVRRSYSSEPTRDVLDTSKKICKIMMSSSPVVLNTALDQSGLRVPPEVVEDVLKRFE 74 Query: 257 NCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQT 436 N G+L Y F W + +Y +++ AY+ +I+ LAK+ Q+ I+W LV++M N + +T Sbjct: 75 NAGMLAYRFFEWAEKQRNY-MHSIRAYHTMIESLAKIRQYQIMWDLVNKMRNKSMLNVET 133 Query: 437 LNIITHGYVMHDKVDQAL 490 II Y KV++ + Sbjct: 134 FCIIMRRYARVQKVEETV 151 >ref|XP_002889139.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334980|gb|EFH65398.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 482 Score = 75.9 bits (185), Expect = 5e-12 Identities = 39/136 (28%), Positives = 71/136 (52%) Frame = +2 Query: 83 LWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNC 262 L AR Y+ + D A ++ + K+L++ ++ AL + ++ VED L N Sbjct: 19 LSARLYSSSEQVRDVADVAKNISKVLMSSPQLVIDSALDQSGLRVSPEVVEDVLYRFRNA 78 Query: 263 GLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLN 442 GLL Y F W + HY+ ++ AY+++I+ AK+ Q+ ++W L++ M + +T Sbjct: 79 GLLAYRFFQWSEKQRHYE-HSVRAYHMMIESTAKIRQYKLMWDLINAMMKKKMLNVETFC 137 Query: 443 IITHGYVMHDKVDQAL 490 I+ Y KVD+A+ Sbjct: 138 IVMRKYARAQKVDEAI 153 >ref|XP_006301167.1| hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] gi|482569877|gb|EOA34065.1| hypothetical protein CARUB_v10021564mg, partial [Capsella rubella] Length = 486 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/126 (27%), Positives = 67/126 (53%) Frame = +2 Query: 113 PLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFTW 292 P D A ++ + K++++ ++ AL + +++ VED L N GLL Y F W Sbjct: 33 PARDVADVAKNISKVMMSSPQLVLDSALDQSGLRVSQEVVEDVLNRFRNAGLLAYRFFQW 92 Query: 293 PPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMHD 472 + HY+ ++ AY+++I+ AK+ Q+ ++W L++ M + +T I+ Y Sbjct: 93 SEKQRHYE-HSVRAYHMMIESTAKIRQYKLMWDLINSMRKKKMLNIETFCIVMRKYARAQ 151 Query: 473 KVDQAL 490 KVD+A+ Sbjct: 152 KVDEAI 157 >ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Glycine max] gi|571460055|ref|XP_006581592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Glycine max] gi|571460057|ref|XP_006581593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Glycine max] gi|571460059|ref|XP_006581594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X5 [Glycine max] gi|571460061|ref|XP_006581595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X6 [Glycine max] Length = 481 Score = 72.8 bits (177), Expect = 4e-11 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 1/146 (0%) Frame = +2 Query: 56 RHQEIEQWTLWARAY-AVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAV 232 R + +W ++ + + A + D S ++ K+++T ++ AL + ++ V Sbjct: 8 RSKIFSKWVVFTKMHSASEAMIQDVGEASERVCKVMMTCPTLGLDTALNQTGVRVSPDLV 67 Query: 233 EDALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHN 412 E+ L+ N G+ + F W + Y ++ AY+L+I+ LAK+ Q+ IVW LV M Sbjct: 68 ENVLKRFENAGMPAFRFFEWAEKQRGYS-HSIRAYHLMIESLAKIRQYQIVWDLVSAMRK 126 Query: 413 LGFITKQTLNIITHGYVMHDKVDQAL 490 G + +T I+ Y +KVD+A+ Sbjct: 127 KGMLNVETFCIMMRKYARANKVDEAV 152 >gb|ABK26722.1| unknown [Picea sitchensis] Length = 198 Score = 72.4 bits (176), Expect = 6e-11 Identities = 39/143 (27%), Positives = 73/143 (51%), Gaps = 3/143 (2%) Frame = +2 Query: 71 EQWTLWARAYAVVTPLDDE---ARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDA 241 ++W + + A LD + A++ +K+ K+L + + L + K + VE+ Sbjct: 12 QKWRRFVHSSAQTRTLDGDRLQAKSLKKICKILTSSPTADVSEVLQKSKVEASPKLVEEV 71 Query: 242 LRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGF 421 L N G+ Y F W + Y ++ EAY+++I L K+ Q+ ++WT+V+ M G Sbjct: 72 LMRFENAGMQAYRFFEWAGKQQDY-AHSVEAYHIIIDSLGKIQQYGLMWTVVNLMKIKGV 130 Query: 422 ITKQTLNIITHGYVMHDKVDQAL 490 +TK+T II Y K+++A+ Sbjct: 131 LTKETFAIIMRRYARAKKIEEAV 153 >ref|XP_006390097.1| hypothetical protein EUTSA_v10018469mg [Eutrema salsugineum] gi|557086531|gb|ESQ27383.1| hypothetical protein EUTSA_v10018469mg [Eutrema salsugineum] Length = 482 Score = 71.6 bits (174), Expect = 1e-10 Identities = 37/146 (25%), Positives = 74/146 (50%) Frame = +2 Query: 53 QRHQEIEQWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAV 232 Q + ++ + A+ Y+ D A + K+ K++++ ++ AL + ++ V Sbjct: 9 QSRLSLRRYIVSAKLYSSGGQAIDVAVVANKISKVMMSSPQPVLDSALDQSGLRVSPEVV 68 Query: 233 EDALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHN 412 E+ L N GLL Y F W + HY+ ++ AY+++I+ AK+ Q+ ++W L++ M Sbjct: 69 ENVLNRFRNAGLLAYRFFQWSEKQRHYE-HSVRAYHMMIESTAKIKQYKLMWDLINSMRK 127 Query: 413 LGFITKQTLNIITHGYVMHDKVDQAL 490 + +T I+ Y KVD+A+ Sbjct: 128 KKTLNIETFCIVMRKYARAQKVDEAI 153 >ref|XP_004161997.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g71060, mitochondrial-like [Cucumis sativus] Length = 542 Score = 71.6 bits (174), Expect = 1e-10 Identities = 42/151 (27%), Positives = 76/151 (50%), Gaps = 2/151 (1%) Frame = +2 Query: 44 SRKQRHQEIE--QWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANL 217 S + H IE + L A ++V D+ A+ + K K++ +E L L Sbjct: 62 SHRSTHHRIEHSKQDLKASQKSIVES-DEIAQDAEKFCKLISKNPNSCIESLLDGAPMEL 120 Query: 218 TKGAVEDALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLV 397 + + + L+ + N G L + F W + + +T E+YNL+I+ L K+ QF+++W LV Sbjct: 121 SPALIVEVLKKLSNAGFLALSFFRWAEKQKGFK-HTTESYNLLIEALGKIKQFNVIWNLV 179 Query: 398 DEMHNLGFITKQTLNIITHGYVMHDKVDQAL 490 +M G ++++T +IT Y KV +A+ Sbjct: 180 SDMKRKGILSRETFALITRRYARARKVKEAV 210 >ref|XP_004150483.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, mitochondrial-like [Cucumis sativus] Length = 542 Score = 71.6 bits (174), Expect = 1e-10 Identities = 42/151 (27%), Positives = 76/151 (50%), Gaps = 2/151 (1%) Frame = +2 Query: 44 SRKQRHQEIE--QWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANL 217 S + H IE + L A ++V D+ A+ + K K++ +E L L Sbjct: 62 SHRSTHHRIEHSKQDLKASQKSIVES-DEIAQDAEKFCKLISKNPNSCIESLLDGAPMEL 120 Query: 218 TKGAVEDALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLV 397 + + + L+ + N G L + F W + + +T E+YNL+I+ L K+ QF+++W LV Sbjct: 121 SPALIVEVLKKLSNAGFLALSFFRWAEKQKGFK-HTTESYNLLIEALGKIKQFNVIWNLV 179 Query: 398 DEMHNLGFITKQTLNIITHGYVMHDKVDQAL 490 +M G ++++T +IT Y KV +A+ Sbjct: 180 SDMKRKGILSRETFALITRRYARARKVKEAV 210 >ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Glycine max] Length = 454 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/125 (28%), Positives = 65/125 (52%) Frame = +2 Query: 116 LDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFTWP 295 + D S ++ K+++T ++ AL + ++ VE+ L+ N G+ + F W Sbjct: 2 IQDVGEASERVCKVMMTCPTLGLDTALNQTGVRVSPDLVENVLKRFENAGMPAFRFFEWA 61 Query: 296 PRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMHDK 475 + Y ++ AY+L+I+ LAK+ Q+ IVW LV M G + +T I+ Y +K Sbjct: 62 EKQRGYS-HSIRAYHLMIESLAKIRQYQIVWDLVSAMRKKGMLNVETFCIMMRKYARANK 120 Query: 476 VDQAL 490 VD+A+ Sbjct: 121 VDEAV 125 >ref|XP_002307458.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550339385|gb|EEE94454.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/119 (26%), Positives = 67/119 (56%) Frame = +2 Query: 134 TSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFTWPPRHNHY 313 T++ + K++++ T++ AL + +++ V+D L+ N G++ Y F W + HY Sbjct: 31 TTKTICKIMMSSSVVTLDTALDQSGVRVSEQIVDDVLKKFENAGMVAYRFFEWAEKQRHY 90 Query: 314 DVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMHDKVDQAL 490 + ++ +A++ VI LAK+ Q+ ++W +V M + + +T II Y KV++A+ Sbjct: 91 N-HSVKAFHTVIDSLAKIRQYQLMWDVVKVMKSKRMVNVETFCIIMRKYARAQKVEEAV 148 >ref|XP_002280443.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71060, mitochondrial [Vitis vinifera] Length = 531 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/121 (28%), Positives = 67/121 (55%) Frame = +2 Query: 128 ARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFTWPPRHN 307 A+ + KL K+L T ++E L +++ V + L+ + N G++ + F W + Sbjct: 80 AQDTGKLCKLLCTHSNSSIESLLNGASVDVSPTLVLEVLKKLSNSGVIALSFFRWAEKQK 139 Query: 308 HYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMHDKVDQA 487 + +T E YN +I+ L K+ QF ++W LV++M + G +T++T +I+ Y KV +A Sbjct: 140 GFKYST-ENYNALIEALGKIKQFKMIWNLVNDMRSKGLLTQETFALISRRYARARKVKEA 198 Query: 488 L 490 + Sbjct: 199 V 199 >ref|XP_006390810.1| hypothetical protein EUTSA_v10018364mg [Eutrema salsugineum] gi|557087244|gb|ESQ28096.1| hypothetical protein EUTSA_v10018364mg [Eutrema salsugineum] Length = 548 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 3/127 (2%) Frame = +2 Query: 119 DDEARTSR---KLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFT 289 DDE R S+ ++ K++ ++E L L+ +E+ L+ + N G+L ++F Sbjct: 95 DDEIRVSQDAERICKIVSKISDSSVENLLDEASVKLSPALMEEVLKKLSNAGVLALSVFK 154 Query: 290 WPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMH 469 W + +T +YN +I+ L K+ QF +VW+LVD+M ++K T +I+ Y Sbjct: 155 WAENQKGFK-HTTASYNTLIESLGKIKQFKLVWSLVDDMKQKKLLSKDTFALISRRYARA 213 Query: 470 DKVDQAL 490 KV +A+ Sbjct: 214 RKVKEAI 220 >gb|EOY00910.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508709014|gb|EOY00911.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 545 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/116 (26%), Positives = 64/116 (55%) Frame = +2 Query: 143 KLKKMLLTGRAFTMERALGRVKANLTKGAVEDALRGVPNCGLLGYNLFTWPPRHNHYDVN 322 K+ K+L + +++ L ++ V + L+ + N G++ + FTW + + N Sbjct: 96 KICKLLSSRSDIHVDKLLENASIEVSPSLVAEVLKRLSNAGVIAMSFFTWAEKQKGFKYN 155 Query: 323 TPEAYNLVIQCLAKVGQFDIVWTLVDEMHNLGFITKQTLNIITHGYVMHDKVDQAL 490 T E+YN +I+ L K+ QF ++W L+++M + ++K T +I+ Y KV++A+ Sbjct: 156 T-ESYNALIEALGKIKQFKLIWNLLNDMKSSKLLSKDTFALISRRYARARKVEEAI 210 >ref|XP_006472835.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Citrus sinensis] gi|568837650|ref|XP_006472836.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Citrus sinensis] gi|568837652|ref|XP_006472837.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Citrus sinensis] gi|568837654|ref|XP_006472838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Citrus sinensis] Length = 480 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/145 (26%), Positives = 71/145 (48%) Frame = +2 Query: 56 RHQEIEQWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVE 235 R++ I + R Y P + ++ + K++L+ ++ AL + ++ VE Sbjct: 8 RNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVE 67 Query: 236 DALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNL 415 D L N G L + F W + +Y+ ++ AY+ +I+ LAK+ Q+ I+W LV+ M Sbjct: 68 DVLEKFKNAGTLAFCFFKWTEKQQNYE-HSVRAYHSMIESLAKIRQYQIMWDLVNAMRTK 126 Query: 416 GFITKQTLNIITHGYVMHDKVDQAL 490 + +T II Y KV++A+ Sbjct: 127 RMLNVETFCIIMRKYARVQKVEEAV 151 >ref|XP_006434266.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883417|ref|XP_006434267.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883419|ref|XP_006434268.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883421|ref|XP_006434269.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|567883423|ref|XP_006434270.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536388|gb|ESR47506.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536389|gb|ESR47507.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536390|gb|ESR47508.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536391|gb|ESR47509.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] gi|557536392|gb|ESR47510.1| hypothetical protein CICLE_v10000990mg [Citrus clementina] Length = 480 Score = 67.0 bits (162), Expect = 2e-09 Identities = 38/145 (26%), Positives = 71/145 (48%) Frame = +2 Query: 56 RHQEIEQWTLWARAYAVVTPLDDEARTSRKLKKMLLTGRAFTMERALGRVKANLTKGAVE 235 R++ I + R Y P + ++ + K++L+ ++ AL + ++ VE Sbjct: 8 RNKMISGCISFLRRYNSSEPSTEALDAAKSISKIMLSSPKVVLDTALDQSGIRVSPEIVE 67 Query: 236 DALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWTLVDEMHNL 415 D L N G L + F W + +Y+ ++ AY+ +I+ LAK+ Q+ I+W LV+ M Sbjct: 68 DVLEKFKNAGTLAFCFFKWAEKQQNYE-HSVRAYHSMIESLAKIRQYQIMWDLVNAMRTK 126 Query: 416 GFITKQTLNIITHGYVMHDKVDQAL 490 + +T II Y KV++A+ Sbjct: 127 RMLNVETFCIIMRKYARVQKVEEAV 151 >ref|XP_002315895.2| hypothetical protein POPTR_0010s12490g [Populus trichocarpa] gi|550329653|gb|EEF02066.2| hypothetical protein POPTR_0010s12490g [Populus trichocarpa] Length = 488 Score = 67.0 bits (162), Expect = 2e-09 Identities = 40/153 (26%), Positives = 75/153 (49%), Gaps = 3/153 (1%) Frame = +2 Query: 41 ISRKQRHQEIEQWTLWARAYAVVTP---LDDEARTSRKLKKMLLTGRAFTMERALGRVKA 211 I K H +++Q + A + TP D + + K+L ++E L + Sbjct: 7 IVHKSTHTDLQQTVVLTDA-SNQTPQVLADKIVEDAENICKLLSKNPNSSVEALLNKASM 65 Query: 212 NLTKGAVEDALRGVPNCGLLGYNLFTWPPRHNHYDVNTPEAYNLVIQCLAKVGQFDIVWT 391 ++ V +AL+ + N G L + F W + + +T E+Y+ +I+ L K+ QF+++W Sbjct: 66 EVSPSLVFEALKKLSNAGALALSFFRWAEKQKGFQYST-ESYHALIESLGKIKQFNVIWN 124 Query: 392 LVDEMHNLGFITKQTLNIITHGYVMHDKVDQAL 490 LV +M G + K+T +I+ Y KV +A+ Sbjct: 125 LVTDMKQKGLLNKETFALISRRYARARKVKEAV 157