BLASTX nr result
ID: Ephedra27_contig00028449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00028449 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841929.1| hypothetical protein AMTR_s00042p00201380 [A... 56 6e-06 >ref|XP_006841929.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda] gi|548843955|gb|ERN03604.1| hypothetical protein AMTR_s00042p00201380 [Amborella trichopoda] Length = 852 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = -1 Query: 394 GQKFGYSPSKVLNEEGAEIEEIDVIRDGDHLFL 296 G+KFG+SP+KV+N E AE+E+I+ +RDGDHLFL Sbjct: 814 GEKFGFSPTKVVNSEDAEVEDIEAVRDGDHLFL 846