BLASTX nr result
ID: Ephedra27_contig00028036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00028036 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002520003.1| hypothetical protein EpeqC_p069 (chloroplast... 138 9e-31 dbj|BAH11181.1| hypothetical protein (chloroplast) [Welwitschia ... 76 5e-12 ref|YP_001876624.1| hypothetical chloroplast RF1 [Welwitschia mi... 76 5e-12 ref|YP_008439047.1| hypothetical chloroplast RF1 [Medicago trunc... 74 2e-11 ref|YP_538982.1| hypothetical chloroplast RF1 [Gossypium hirsutu... 73 3e-11 ref|YP_008992867.1| hypothetical chloroplast RF19 (chloroplast) ... 73 3e-11 ref|YP_008992781.1| hypothetical chloroplast RF19 (chloroplast) ... 73 3e-11 ref|YP_008992522.1| hypothetical chloroplast RF19 (chloroplast) ... 73 3e-11 ref|YP_006503488.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_006503405.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_006503322.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_005088325.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_005088961.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_005087834.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_005088421.1| hypothetical chloroplast RF1 (chloroplast) [... 73 3e-11 ref|YP_004286061.1| hypothetical chloroplast RF19 [Gossypium thu... 73 3e-11 ref|YP_002149777.1| hypothetical chloroplast RF19 [Cicer arietin... 73 3e-11 ref|YP_913244.1| hypothetical protein GobaCp080 [Gossypium barba... 73 3e-11 ref|YP_008439123.1| hypothetical chloroplast RF1 [Medicago trunc... 72 8e-11 ref|XP_003604157.1| hypothetical protein MTR_4g006080 [Medicago ... 72 8e-11 >ref|YP_002520003.1| hypothetical protein EpeqC_p069 (chloroplast) [Ephedra equisetina] gi|220983604|dbj|BAH11371.1| hypothetical protein (chloroplast) [Ephedra equisetina] Length = 2018 Score = 138 bits (347), Expect = 9e-31 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 1/75 (1%) Frame = -1 Query: 423 KKPKRK-NVEDNFYFHQNFNQKITKNIYLESKIKMKQTLWPSYRLEDLLCMNRYWFNTAD 247 KKPK+K NVEDNF+F NQKITKNIYLESK+KMKQTLWPSYRLEDLLCMNRYWFNTAD Sbjct: 1948 KKPKKKKNVEDNFHF----NQKITKNIYLESKVKMKQTLWPSYRLEDLLCMNRYWFNTAD 2003 Query: 246 GSRNSIWRIRMFCLF 202 GSRNSIWRIR+FCLF Sbjct: 2004 GSRNSIWRIRIFCLF 2018 >dbj|BAH11181.1| hypothetical protein (chloroplast) [Welwitschia mirabilis] Length = 2575 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = -1 Query: 387 YFHQNFNQKITKNIYLESKIKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMFC 208 +FH+ +K K L+ K +K+ +WPS+RLEDLLCM+RYW+NT DGSRNS+ R+RM+ Sbjct: 2512 FFHKKSRKKKKKTKKLDPKKIIKRFIWPSFRLEDLLCMSRYWYNTTDGSRNSLIRLRMYP 2571 Query: 207 L 205 L Sbjct: 2572 L 2572 >ref|YP_001876624.1| hypothetical chloroplast RF1 [Welwitschia mirabilis] gi|163311679|gb|ABY26837.1| hypothetical chloroplast RF1 [Welwitschia mirabilis] Length = 2659 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = -1 Query: 387 YFHQNFNQKITKNIYLESKIKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMFC 208 +FH+ +K K L+ K +K+ +WPS+RLEDLLCM+RYW+NT DGSRNS+ R+RM+ Sbjct: 2596 FFHKKSRKKKKKTKKLDPKKIIKRFIWPSFRLEDLLCMSRYWYNTTDGSRNSLIRLRMYP 2655 Query: 207 L 205 L Sbjct: 2656 L 2656 >ref|YP_008439047.1| hypothetical chloroplast RF1 [Medicago truncatula] gi|404332374|gb|AFR60005.1| hypothetical chloroplast RF1 [Medicago truncatula] Length = 1764 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/71 (53%), Positives = 48/71 (67%), Gaps = 4/71 (5%) Frame = -1 Query: 411 RKNVEDNFYFHQNFNQKITKNIYLESKIK----MKQTLWPSYRLEDLLCMNRYWFNTADG 244 RK + DN +N +Q +TKN L+S+ K K LWP+YRLEDL C+NRYWFNT +G Sbjct: 1689 RKTINDNENQIKNVSQVLTKNKDLDSETKKLMNFKLFLWPNYRLEDLACINRYWFNTHNG 1748 Query: 243 SRNSIWRIRMF 211 S SI RIRM+ Sbjct: 1749 SHFSILRIRMY 1759 >ref|YP_538982.1| hypothetical chloroplast RF1 [Gossypium hirsutum] gi|118574750|sp|Q2L951.1|YCF1_GOSHI RecName: Full=Putative membrane protein ycf1; Short=RF1 gi|85687462|gb|ABC73674.1| hypothetical chloroplast RF1 [Gossypium hirsutum] gi|329317215|gb|AEB90573.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium hirsutum] gi|329317299|gb|AEB90656.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium hirsutum] Length = 1892 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1827 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1886 >ref|YP_008992867.1| hypothetical chloroplast RF19 (chloroplast) [Gossypium stocksii] gi|326457446|gb|ADZ74706.1| hypothetical chloroplast RF19 [Gossypium stocksii] Length = 1888 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1823 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1882 >ref|YP_008992781.1| hypothetical chloroplast RF19 (chloroplast) [Gossypium longicalyx] gi|326457358|gb|ADZ74619.1| hypothetical chloroplast RF19 [Gossypium longicalyx] Length = 1893 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1828 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1887 >ref|YP_008992522.1| hypothetical chloroplast RF19 (chloroplast) [Gossypium anomalum] gi|326457096|gb|ADZ74360.1| hypothetical chloroplast RF19 [Gossypium anomalum] Length = 1887 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1822 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1881 >ref|YP_006503488.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium capitis-viridis] gi|335354559|gb|AEH43177.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium capitis-viridis] Length = 1888 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1823 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1882 >ref|YP_006503405.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium somalense] gi|394830948|ref|YP_006503571.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium areysianum] gi|335354475|gb|AEH43094.1| hypothetical chloroplast RF1 [Gossypium somalense] gi|335354643|gb|AEH43260.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium areysianum] Length = 1892 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1827 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1886 >ref|YP_006503322.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium incanum] gi|335354391|gb|AEH43011.1| hypothetical chloroplast RF1 [Gossypium incanum] Length = 1890 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1825 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1884 >ref|YP_005088325.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium tomentosum] gi|318084797|gb|ADV39268.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium tomentosum] Length = 1892 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1827 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1886 >ref|YP_005088961.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium mustelinum] gi|318084627|gb|ADV39100.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium mustelinum] Length = 1894 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1829 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1888 >ref|YP_005087834.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium darwinii] gi|318084458|gb|ADV38933.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium darwinii] gi|329317383|gb|AEB90739.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium barbadense] gi|329317467|gb|AEB90822.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium barbadense] gi|329317551|gb|AEB90905.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium barbadense] Length = 1890 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1825 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1884 >ref|YP_005088421.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291916|ref|YP_005089044.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium arboreum] gi|318084375|gb|ADV38851.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium arboreum] gi|318084545|gb|ADV39019.1| hypothetical chloroplast RF1 (chloroplast) [Gossypium herbaceum subsp. africanum] Length = 1894 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1829 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1888 >ref|YP_004286061.1| hypothetical chloroplast RF19 [Gossypium thurberi] gi|290775844|gb|ADD62340.1| hypothetical chloroplast RF19 [Gossypium thurberi] Length = 1894 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1829 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1888 >ref|YP_002149777.1| hypothetical chloroplast RF19 [Cicer arietinum] gi|197089845|gb|ACH41115.1| hypothetical chloroplast RF19 [Cicer arietinum] Length = 1801 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 4/72 (5%) Frame = -1 Query: 414 KRKNVEDNFYFHQNFNQKITKNIYLESKIK----MKQTLWPSYRLEDLLCMNRYWFNTAD 247 KRKN +N NF+Q + KN +S+ K +K LWP+YRLEDL CMNRYWF+T + Sbjct: 1727 KRKNYNENKI--NNFSQVLAKNNDFDSETKKLMNLKLFLWPNYRLEDLACMNRYWFDTHN 1784 Query: 246 GSRNSIWRIRMF 211 GSR S+ RIRM+ Sbjct: 1785 GSRFSLLRIRMY 1796 >ref|YP_913244.1| hypothetical protein GobaCp080 [Gossypium barbadense] gi|182702251|sp|A0ZZ93.1|YCF1_GOSBA RecName: Full=Putative membrane protein ycf1 gi|119224919|dbj|BAF41305.1| Hypothetical protein [Gossypium barbadense] Length = 1889 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 4/60 (6%) Frame = -1 Query: 378 QNFNQKITKNIYLESK----IKMKQTLWPSYRLEDLLCMNRYWFNTADGSRNSIWRIRMF 211 +N Q +TKN +L+S IK+K LWP+YRLEDL CMNRYWFNT +GSR S+ RIRM+ Sbjct: 1824 KNCGQVLTKNKHLDSDKKKLIKLKFFLWPNYRLEDLACMNRYWFNTNNGSRFSMIRIRMY 1883 >ref|YP_008439123.1| hypothetical chloroplast RF1 [Medicago truncatula] gi|404332451|gb|AFR60081.1| hypothetical chloroplast RF1 [Medicago truncatula] Length = 1756 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 411 RKNVEDNFYFHQNFNQKITKNIYLESKIK----MKQTLWPSYRLEDLLCMNRYWFNTADG 244 RK + DN +N +Q +TKN L+S+ K K LWP+YRLEDL C+NRYWFNT +G Sbjct: 1681 RKTINDNENQIKNVSQVLTKNKDLDSETKKLMNFKLFLWPNYRLEDLACINRYWFNTHNG 1740 Query: 243 SRNSIWRIRMF 211 S SI RI M+ Sbjct: 1741 SHFSILRIHMY 1751 >ref|XP_003604157.1| hypothetical protein MTR_4g006080 [Medicago truncatula] gi|355505212|gb|AES86354.1| hypothetical protein MTR_4g006080 [Medicago truncatula] Length = 1698 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Frame = -1 Query: 411 RKNVEDNFYFHQNFNQKITKNIYLESKIK----MKQTLWPSYRLEDLLCMNRYWFNTADG 244 RK + DN +N +Q +TKN L+S+ K K LWP+YRLEDL C+NRYWFNT +G Sbjct: 1623 RKTINDNENQIKNVSQVLTKNKDLDSETKKLMNFKLFLWPNYRLEDLACINRYWFNTHNG 1682 Query: 243 SRNSIWRIRMF 211 S SI RI M+ Sbjct: 1683 SHFSILRIHMY 1693