BLASTX nr result
ID: Ephedra27_contig00027847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00027847 (471 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA42246.1| TPA: hypothetical protein ZEAMMB73_079208 [Zea m... 58 1e-06 >tpg|DAA42246.1| TPA: hypothetical protein ZEAMMB73_079208 [Zea mays] Length = 59 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 469 ISQSQWKKYPRGIPRIELGTSCTQSKNHTTRPNVLLSVAF 350 IS + K RGIPRIELGTSCTQSKNHTTRPN LL F Sbjct: 15 ISLNIKKTKKRGIPRIELGTSCTQSKNHTTRPNALLCFTF 54